Competitive Salaries Jobs in USA

284,431 open positions · Updated daily

Looking for Competitive Salaries jobs in USA? Browse our curated listings with transparent salary information to find the perfect Competitive Salaries position in the USA area.

Client Development Director - Channel Partnerships

Company: StackAdapt

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <p> StackAdapt is a selfserve advertising platform that specializes in multichannel solutions including native display video connected TV audio ingame and digital outofhome ads We empower hundreds of digitallyfocused companies to deliver outcomes and exceptional campaign performance everyday StackAdapt was founded with a vision to be more than an advertising platform its a hub of innovation imagination and creativity <p> <p> <p> <p> Are you a proactive problem solver with a passion for programmatic advertising Are you a relationship builder with strong interpersonal communication skills If so then we want to hear from you Were looking for a Client Development Manager to join our expanding Channel Partnerships team in a specialist capacity <p> <p> <p> <p> You will become a foremost expert on the StackAdapt platform while owning the growth and success of enterprise level channel partners post sale The ideal candidate will manage a group of accounts with the goal of exceeding StackAdapts customer success standards building valuable relationships across executive and operator levels and driving new business using a consultative partner based sales approach <p> <p> <p> <p> Successful candidates will be self motivated with a strong track record of quickly understanding client technical needs and business objectives to recommend the right solutions to achieve goals <p> <p> <p> <p> StackAdapt is a Remote First company we are open to candidates located anywhere in the US for this position <p> <p> <p> <p> <p> <p> <strong> What youll be doing <strong> <p> <ul> <li> <p> Act as StackAdapts principle evangelist media thought leader problem solver and point of contact across your account portfolio <p> <li> <li> <p> Accurately forecast business needs and account growth while maintaining a clean pipeline of incremental opportunities <p> <li> <li> <p> Own build and run the rhythm of business across your portfolio through the use of status calls strategy calls office hours QBRs and more <p> <li> <li> <p> Identify and pitch key incremental sales opportunities develop client enablement plans and work cross functionally within StackAdapt to solve client needs and develop new opportunities <p> <li> <ul> <p> <p> <p> <strong> What youll bring to the table <strong> <p> <ul> <li> <p> High level of experience managing enterprise clients within the programmatic advertising space preferably at a Demand Side Platform Trading Desk or Media Agency <p> <li> <li> <p> Comfortable working within a quota based environment with a track record of exceeding targets and successfully growing account portfolios <p> <li> <li> <p> Positive energy proactive mentality highly organized with a growth mindset <p> <li> <li> <p> Bonus if you have worked with API based media clients at a Demand Side Platform <p> <li> <ul> <p> <p> <p> <strong> StackAdapters Enjoy <strong> <p> <ul> <li> <p> Competitive salary + commissions <p> <li> <li> <p> 401K matching <p> <li> <li> <p> 3 weeks vacation + 3 personal care days + 1 Culture amp Belief day + birthdays off <p> <li> <li> <p> Access to a comprehensive mental health care platform <p> <li> <li> <p> Health benefits from day one of employment <p> <li> <li> <p> Work from home reimbursements <p> <li> <li> <p> Optional global WeWork membership for those who want a change from their home office <p> <li> <li> <p> Robust training and onboarding program <p> <li> <li> <p> Coverage and support of personal development initiatives conferences courses etc <p> <li> <li> <p> Access to StackAdapt programmatic courses and certifications to support continuous learning <p> <li> <li> <p> Mentorship opportunities with industry leaders <p> <li> <li> <p> An awesome parental leave policy <p> <li> <li> <p> A friendly welcoming and supportive culture <p> <li> <li> <p> Our social and team events <p> <li> <ul> <p> <p> <p> <p> <p> <p> <p> <p> <p> <em> StackAdapt is a diverse and inclusive team of collaborative hardworking individuals trying to make a dent in the universe No matter who you are where you are from who you love follow in faith disability or superpower status ethnicity or the gender you identify with if youre comfortable let us know your pronouns you are welcome at StackAdapt If you have any requests or requirements to support you throughout any part of the interview process please let our Talent team know <em> <p> <p> <p> <p> <strong> About StackAdapt <strong> <p> <p> <p> <p> Weve been recognized for our diverse and supportive workplace high performing campaigns awardwinning customer service and innovation Weve been awarded <p> <p> <p> <p> <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpsblogstackadaptcomstackadaptnamedadagesbestplacetowork2024utmsource=linkedinamputmmedium=organicsocialamputmcampaign=adagesbestplacetowork2024amputmcontent=blog rel=noopener noreferrer nofollow target=blank> Ad Age Best Places to Work 2024 <a> <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpsblogstackadaptcomg22024bestsoftwareawards rel=noopener noreferrer nofollow target=blank> G2 Top Software and Top Marketing and Advertising Product for 2024 <a> <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpsblogstackadaptcom2023bestplacestoworkuk rel=noopener noreferrer nofollow target=blank> Campaigns Best Places to Work 2023 for the UK <a> <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpsblogstackadaptcombestworkplacesforwomenlist rel=noopener noreferrer nofollow target=blank> 2024 Best Workplaces for Women <a> and <a class=fontbold underline fontbold underline postingslink href=httpsblogstackadaptcom2023bestworkplacesincanadalist rel=noopener noreferrer nofollow target=blank> in Canada <a> by Great Place to Work® <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpswwwg2comproductsstackadaptreviews rel=noopener noreferrer nofollow target=blank> 1 DSP on G2 and leader in a number of categories including CrossChannel Advertising <a> <p> <p> <p> <p> LIRemote <p><p>

Research Associate - siRNA/Peptides + Antibody

Company: Vial

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <p> <strong> Who We Are <strong> <p> <p> <p> <p> Vial is a global techdriven CRO providing nextgeneration clinical trial management services The Vial CRO powers its drug discovery arm Battery Bio an AIpowered hyper scalable biotech Battery Bio harnesses Vials unique 90 lower cost structure to produce more affordable drug development with efficient streamlined clinical trials <p> <p> <p> <p> Our mission is to reimagine the drug discovery process to empower scientists to cure all human disease We have assembled a talented team of clinical operators chemists and innovative thinkers to achieve this vision <p> <p> <p> <p> Vial is a San Francisco Californiabased company founded by Simon Burns in October 2020 Since our founding we have become a fastgrowing company of 100+ employees with over $100 million in funding from esteemed investors including General Catalyst Box Group and Byers Capital <p> <p> <p> <p> Vial is rebuilding the infrastructure to advance research By deploying technology at every step we are creating a more efficient future for drug discovery <p> <p> <p> <p> <strong> What Youll Do <strong> <p> <p> Work in a structurebased computationally driven drug discovery paradigm <p> <p> Iteratively scale rethink and collaborate on a drug discovery engine that will scale to hundreds of programs <p> <p> Work on assay development and process development for Vials in house discovery efforts <p> <p> Research new modalities + new approaches and serve as a thought partner to the team <p> <p> Work with other scientists clinicians computational biologists project managers and external partners to accomplish our mission of curing diseases <p> <p> <p> <p> <strong> What Youll Bring <strong> <p> <p> 35 years of experience in Antibody discoveryprogram development or roles directly related to the Research amp Development of antibody programs <p> <p> Entrepreneurial mindset experience in startup environment preferred a plus <p> <p> Deeply analytical systems thinker focused on finding scalable solutions <p> <p> <p> <p> <p> <p> <p> <p> $90000 $110000 a year <p> <p> <strong> Why Youll Love Working At Vial <strong> <p> <p> <p> <p> <strong> We are innately curiosity <strong> We found our calling in clinical trials after learning the pain points directly It is our curiosity that propels us to keep building finding new challenges and fulfilling our vision of reimagining clinical trials <p> <p> <strong> We believe in autonomy <strong> Team members do their best work when given autonomy In order to make an impact on the scale of the Vial vision we built our culture to enable each Vial team member to feel ownership of their domain <p> <p> <strong> We take pride in building mastery <strong> We believe in building master in a craft Craftsmanship a pride in ones craft is key to prolonged engagement on a difficult challenge Vials culture is one of highly autonomous deeply focused experts working on an immensely hard problem together <p> <p> <strong> Our strength is moving fast and staying humble <strong> We believe that if we build a team that is intellectually honest that we stay nimble and keep an open mind to all solutions well be adaptive and solve the problems that face us at every turn <p> <p> <p> <p> <strong> Benefits <strong> <em> Not applicable to Contract or Temp Positions <em> <p> <p> Competitive Equity Compensation <p> <p> Comprehensive benefits package including Medical Dental and Vision insurance <p> <p> 401k or RRSP Plan with Company Matching after first 90 days of employment <p> <p> One time Remote Office Setup Stipend <p> <p> Paid Parental Leave <p> <p> RemoteFirst Flexible Work Schedule <p> <p> Unlimited Vacation <p> <p> <p><p>

Director - Corporate FP&A

Company: Icertis

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <p> With unmatched technology and categorydefining innovation Icertis pushes the boundaries of whats possible with contract lifecycle management CLM The AIpowered analystvalidated Icertis Contract Intelligence ICI platform turns contracts from static documents into strategic advantage by structuring and connecting the critical contract information that defines how an organization runs Today the worlds most iconic brands and disruptive innovators trust Icertis to fully realize the intent of their combined 10 million contracts worth more than $1 trillion in 40+ languages and 93 countries <p> <p> <p> <p> <strong> Who we are <strong> Icertis is the only contract intelligence platform companies trust to keep them out in front now and in the future Our unwavering commitment to contract intelligence is grounded in our FORTE valuesFairness Openness Respect Teamwork and Executionwhich guide all our interactions with employees customers partners and stakeholders Because in our mission to be the contract intelligence platform of the world we believe how we get there is as important as the destination <p> <p> <p> <p> As the Director of FPampA you will play a critical leadership role you will work closely with all of companys functional leaders and bring key market strategic and operational insights that will shape the direction of the company and accelerate its growth You will also play a key role in telling the companys financial story to investors <p> <p> <p> <p> The ideal candidate will have a proven trackrecord of driving business outcomes through keen financial insight and business modeling They will have the ability to create a 360degree financial picture of the business that reflects and influences the companys strategy and be excellent at communicating with senior leaders and executives They will be toolsavvy with experience in creating scalable data and reporting solutions that support a datadriven culture LIRS1 <p> <p> <p> <p> <p> <p> <strong> What you will do <strong> <p> <ul> <li> <p> Formulate a robust 360degree financial picture of the business complete with market insights and operational drivers <p> <li> <li> <p> Develop and maintain the 3year Strategic Planning Model and forecast <p> <li> <li> <p> Deliver Global PampL and cash flow forecasts <p> <li> <li> <p> Drive Annual Planning Process work cross functionally to build and maintain the Annual Financial Plan and Departmental Budgets <p> <li> <li> <p> Build and deliver Business Performance ReportingOperating dashboards <p> <li> <li> <p> Perform strategic business analysis as needed MampA Geo Expansion <p> <li> <li> <p> Prepare financial analyses as needed to help drive improvements in the business Current focus areas include market expansion opportunities competitive benchmarking analyses pricing and strategic financial optimization strategies <p> <li> <li> <p> Partner with Controller to enhance and accelerate the financial reporting process <p> <li> <li> <p> Identifies and implements system and process improvements to increase the efficiency and effectiveness of planning and reporting workflows <p> <li> <li> <p> Prepare communications to Board of Directors <p> <li> <li> <p> Drive investor presentations and supporting analysis <p> <li> <li> <p> Develop a deep understanding of the business metrics with an eye towards understanding the benefits and risks from a financial perspective and helping to manage key business drivers and desired outcomes <p> <li> <li> <p> Play a key role in preparation of critical public financial documents to support the IPO process including working with bankers and supporting the production of investor materials and SEC filings eg S1 <p> <li> <ul> <p> <p> <p> <strong> What you will bring <strong> <p> <ul> <li> <p> 12+ years of experience of working in direct strategic analysis support of all aspects of the business at all areas of the PampL <p> <li> <li> <p> MBACPA or equivalent experience preferred <p> <li> <li> <p> Demonstrated complex modeling experience this is a handson role and managers are expected to directly contribute and lead by example <p> <li> <li> <p> Highly analytical detailoriented with a commitment to creating a highquality product Naturally inquisitive and able to extract information from various sources to identify and understand the underlying issue Not afraid to question results <p> <li> <li> <p> Prior success working in a fastpaced entrepreneurial environment takes initiative and works independently <p> <li> <li> <p> Working knowledge of accounting principles required including revenue recognition amortization and accrual vs cash accounting Must have a general understanding of financial statements <p> <li> <li> <p> Must have exceptional written visual and spoken communication skills <p> <li> <li> <p> Experience in preparing and delivering executive board and investor level communications <p> <li> <li> <p> IPO experience is a plus <p> <li> <li> <p> Must have advanced Excel Netsuite and Powerpoint skills <p> <li> <li> <p> Experience implementing financial analysis and planning tools required <p> <li> <ul> <p> <p> <p> <p> <p> $146000 $219000 a year <p> <p> <em> Pay offered will vary based on jobrelated factors such as location experience training skills and abilities In addition to the base salary and annual bonus target and an equity component is included in the compensation package <em> <p> <p> <strong> What we offer <strong> <p> <p> We are committed to the health and wellbeing of all Icertians their families the communities they live in and our customers This commitment is represented in the Icertis Four Rings of Responsibility Take Care of Self Take Care of Family Take Care of Community and Take Care of Business in that order <p> <p> <p> <p> To support these commitments Icertis offers excellent health and welfare benefits a generous 401k match and a robust paid time off program Here are some of the other reasons <a class=fontbold underline fontbold underline postingslink href=httpswwwicertiscomcompanynewsicertisplacesfirstinwashingtons100bestcompaniestoworkfor rel=noopener noreferrer nofollow target=blank> Icertis Places First in Washingtons 100 Best Companies to Work For | Icertis <a> <p> <p> <p> <p> ● Equity RSUs and shared ownership in the company <p> <p> ● Flexible work environment <p> <p> ● Paid maternity and paternity leave <p> <p> ● 7 Days for Humanity 7 paid volunteer days <p> <p> ● Generous holidays including the 4th of July week off paid <p> <p> ● Free professional and leadership coaching <p> <p> ● Annual personal development allowance <p> <p> <p> <p> Icertis Inc provides Equal Employment Opportunity to all employees and applicants for employment without regard to race color religion gender identity or expression sex sexual orientation national origin age disability genetic information marital status amnesty or status as a covered veteran in accordance with applicable federal state and local laws Icertis Inc complies with applicable state and local laws governing nondiscrimination in employment in every location in which the company has facilities If you are in need of accommodation or special assistance to navigate our website or to complete your application please send an email with your request to <a class=fontbold underline fontbold underline postingslink href=mailtocareersicertiscom rel=noopener noreferrer nofollow target=blank> careersicertiscom <a> or get in touch with your recruiter <p> <p> <p> <p> By submitting your application you acknowledge that you have read Icertiss Privacy Policy <a class=fontbold underline fontbold underline postingslink href=httpswwwicertiscomprivacystatement rel=noopener noreferrer nofollow target=blank> httpswwwicertiscomprivacystatement <a> <p> <p> <p> <p> Icertis is not open to third party solicitation or resumes for our posted FTE positions Resumes received from third party agencies that are unsolicited will be considered complimentary <p><p>

Head of Global Audio

Company: The Athletic Media Company

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <p> <strong> About Us <strong> <p> <p> <p> <p> The Athletic is a digital sports media company that brings true sports fans closer to the athletes teams and leagues that captivate their attention We serve a multifaceted audience that craves a richer connection and understanding with immersive storytelling and a likeminded community of fans Founded in 2016 and with major operational hubs in San Francisco Los Angeles London and Melbourne we empower a truly global team of more than 600 creators and cover more than 250 professional sports and collegiate teams across the United States Canada and the UK Our newsroom has produced thousands of indepth reports along with more than 120 podcasts and other forms of premium content Put simply The Athletic is at the center of a sports fans universe <p> <p> <p> <p> <p> <p> <strong> About the Role <strong> <p> <p> <p> <p> The Athletic has one of the worlds leading sports podcast networks and we are looking for an industry leader and creative visionary to push our podcasts into its next successful phase The Head of Global Audio will have creative accountability for all The Athletic podcasts in addition to leading the North American and International teams This leader will be tasked with developing the highest quality audio shows that fit The Athletics journalistic sensibility and also can reach large and engaged audiences both evolving existing shows and new Central to this creative success will be the leadership of our audio teams globally pushing their creative capabilities and creating a culture in which their teams can thrive <p> <p> <p> <p> <p> <p> <strong> Responsibilities <strong> <p> <ul> <li> <p> Manage the production and growth teams with regular check in and manage the staff of the entire audio department <p> <li> <li> <p> Partner with leadership to set ambitious goals and manage the team effectively toward those goals with wide latitude in how goals are accomplished <p> <li> <li> <p> Understand where tradeoffs need to happen across shows and be proactive with solutions <p> <li> <li> <p> Build podcasts with a diverse set of hosts and guests <p> <li> <li> <p> Curate formats shows and hosts that will offer subscribers a distinctive high quality and entertaining experience that helps drive commercial revenue <p> <li> <li> <p> Think about properties as franchises and come up with new ways to build audiencepromote network growth <p> <li> <li> <p> Partner with vertical leads across the newsroom to align with and complement our editorial strategy <p> <li> <li> <p> Work with the Managing Editor of video to develop a video strategy around our audio properties that serves as both a complement to audio and a new platform to build original Athletic content <p> <li> <li> <p> Work closely with the commercial team to monetize content and create strong long lasting brand partnerships <p> <li> <li> <p> Serve as the connective tissue between audio production and the heads of all other departments within the company to ensure that the audio teams output is appropriately supported promoted and monetized <p> <li> <li> <p> Develop meaningful relationships with leaders throughout HQ <p> <li> <li> <p> Provide input into the organization of the production team to ensure the team is set up to achieve its ambitious growth targets while staying within budget <p> <li> <ul> <p> <p> <p> <strong> Requirements <strong> <p> <ul> <li> <p> 10+ years of experience producing a national broadcast in an audio or video format <p> <li> <li> <p> A track record when it comes to launching and sustaining successful podcasts or video series <p> <li> <li> <p> Expert knowledge of a wide range of audio formats and distribution channels Has a finger on the pulse of industry trends and can see ahead 1218 months <p> <li> <li> <p> Has a deep understanding of sports with a fluency in how topics are covered and discussed by fans Has an ear for high quality creative output that resonates with listeners <p> <li> <li> <p> Is an excellent leader who enjoys facilitating the personal development of colleagues <p> <li> <li> <p> Selfstarter with great time management skills <p> <li> <li> <p> Strong attention to detail and highly organized <p> <li> <li> <p> Ability to execute in the short term while planning long term <p> <li> <li> <p> Ability to make difficult decisions for the good of the business <p> <li> <li> <p> Excellent written and verbal communication skills <p> <li> <li> <p> This is a remotebased position in the United States United Kingdom or Canada that may require some travel <p> <li> <ul> <p> <p> <p> <p> <p> <em> The annual base salary range for this role is $18500000 $20000000 USD The total compensation offered for this position may vary based on factors such as education experience skills and location It may also include noncash rewards and benefits The base salary range is subject to change and may be modified in the future <em> <p> <p> <p> <p> <em> The Athletic offers unique perks and benefits to all fulltime employees based on their country of residence Our comprehensive US benefits package includes <em> <p> <p> <p> <p> <em> Highly competitive employercontributed medical dental vision basic life and disability insurance plans <em> <p> <p> <em> Savings accounts for medical wellness and childcare expenses <em> <p> <p> <em> 401k retirement savings plan and employer match <em> <p> <p> <em> Paid time off including paid sick leave 12 paid holidays 15 days of accrued vacation to start and up to 20 weeks of Paid Parental Leave <em> <p> <p> <p> <p> <em> For international candidates Our global benefits packages offer similar benefits and perks competitive to the local market <em> <p> <p> <p> <p> <em> The Athletic Media Company is an equal opportunity employer and enthusiastically encourages people from all backgrounds and experiences to apply The Athletic will consider all applicants without regard to race religion color national origin ancestry physical andor mental disability medical condition genetic information marital status sex gender gender identity gender expression transgender status age sexual orientation military or veteran status or any other protected characteristic under applicable law <em> <p> <p> <p> <p> <em> Click here to review our <em> <a class=fontbold underline fontbold underline postingslink href=httpsprivacytheathleticcompoliciesname=globalprivacypolicywhatinformationdowegatheraboutyou rel=noopener noreferrer nofollow target=blank> <em> Applicant Privacy Notice <em> <a> <em> which describes how and when The Athletic Media Company collects uses and shares certain personal information of job applicants and prospective employees <em> <p> <p> <p> <p> <em> Beware of fraudulent job recruiting schemes Our recruiters use <em> <a class=fontbold underline fontbold underline postingslink href=mailtocareerstheathleticcom rel=noopener noreferrer nofollow target=blank> <em> careerstheathleticcom <em> <a> <em> exclusively We do not conduct interviews via text or instant message and we do not ask candidates to download software to purchase equipment through us or to provide sensitive personally identifiable information such as bank accounts or social security numbers If you have been contacted by someone claiming to be a recruiter with The Athletic but operating from a different email address about a job offer please report it as potential job fraud to the law enforcement and to <em> <a class=fontbold underline fontbold underline postingslink href=mailtopeopletheathleticcom rel=noopener noreferrer nofollow target=blank> <em> peopletheathleticcom <em> <a> <em> <em> <p><p>

Machine Learning Engineer (L3)

Company: Twilio

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <h3> <strong> See yourself at Twilio <strong> <h3> <p> Join the team as Twilios next Machine Learning Engineer L3 on the Data Services and Throughput team <p> <h3> <strong> Who we are amp why were hiring <strong> <h3> <p> Twilio powers realtime business communications and data solutions that help <a class=fontbold underline fontbold underline fontbold underline href=httpscustomerstwiliocom rel=noopener noreferrer nofollow target=blank> companies and developers worldwide <a> build better applications and customer experiences <p> <p> Although were headquartered in San Francisco we have presence throughout South America Europe Asia and Australia Were on a journey to becoming a global company that actively opposes racism and all forms of oppression and bias At Twilio we support <a class=fontbold underline fontbold underline fontbold underline href=httpswwwtwiliocomcompanydiversity rel=noopener noreferrer nofollow target=blank> diversity equity amp inclusion <a> wherever we do business <p> <h3> <strong> About the job <strong> <h3> <p> This position is needed to to drive the innovation and creation of cuttingedge products that serve the needs of developers builders and operators You will be a crucial bridge between Product and Design tasked with developing evaluating and maintaining scalable Machine Learning models within lowlatency for realtime applications Your collaboration and expertise will be fundamental in delivering robust solutions that power our users success You will be closely working with a crossfunctional team of engineers architects product UIUX and partners to develop ML and data driven algorithm aspects of customer facing products in Twilio Communication applications <p> <p> Twilio Communications is the leading software for sending messages programmatically The Data Services and Throughput organization builds AIenabled capabilities that separate Twilio from its competitors in messaging capabilities <p> <h3> <strong> Responsibilities <strong> <h3> <p> In this role youll <p> <ul> <li> <p> Build and maintain scalable high quality machine learning solutions in production <p> <li> <li> <p> Design and implement tools and procedures to evaluate performance and accuracy of models and data <p> <li> <li> <p> Work closely with software engineers build tools to enhance productivity and to ship and maintain ML models <p> <li> <li> <p> Demonstrate endtoend understanding of applications and why behind models amp systems and develop high quality MLbased software at scale <p> <li> <li> <p> Truly own the product you work on Be responsible for SLA on call incident resolution customer feedback and participate in blameless postmortems to make our products better <p> <li> <li> <p> Partner with product managers tech leads and stakeholders to analyze business problems clarify requirements and define the scope of the systems and leverage stateoftheart Statistics Machine Learning Deep Learning and Gen AI to address the business problems <p> <li> <li> <p> Drive high engineering standards on the team through code review automated testing and mentoring <p> <li> <li> <p> Collaborate and brainstorm product ideas with product managers designers and engineers <p> <li> <ul> <h3> <strong> Qualifications <strong> <h3> <p> Not all applicants will have skills that match a job description exactly Twilio values diverse experiences in other industries and we encourage everyone who meets the required qualifications to apply While having desired qualifications make for a strong candidate we encourage applicants with alternative experiences to also apply If your career is just starting or hasnt followed a traditional path dont let that stop you from considering Twilio We are always looking for people who will bring something new to the table <p> <p> <strong> Required <strong> <p> <ul> <li> <p> 4+ years of applied ML experience <p> <li> <li> <p> Strong background in the foundations of machine learning and building blocks of modern deep learning <p> <li> <li> <p> Proficiency in Python or Java and familiarity with design patterns <p> <li> <li> <p> Track record of building shipping and maintaining machine learning models in production <p> <li> <li> <p> Extensive experience in technologies such as PyTorch Tensorflow Scikitlearn Spacy NLTK application frameworks eg Flask <p> <li> <li> <p> Deep understanding of ML model implementation cycle eg feature engineering trainingserving AB test model selection etc algorithms eg xgboost time series models deep learning graph neural networks optimization and domains eg forecasting personalization and recommendation system NLP embedding representation <p> <li> <li> <p> Familiarity with MLOps concepts related and maintaining models in production such as testing versioning model registry retraining and monitoring <p> <li> <li> <p> Demonstrated ability to ramp up understand and operate effectively in new application business domains <p> <li> <li> <p> Good written and verbal communication skills You are confident in writing down and presenting your designs and decisions throughout the development lifecycle You are also comfortable providing and receiving feedback in an Agile environment <p> <li> <ul> <p> <strong> Desired <strong> <p> <ul> <li> <p> Experience in recommendation systems forecasting models NLP techniques embedding representation approaches and statistical models <p> <li> <li> <p> Experience with Retrieval Augmented Generation Large Language Models and prompt engineering <p> <li> <li> <p> Knowledge of Java and system design concepts <p> <li> <li> <p> Understanding of Experience with CICD pipelines and automated deployment processes <p> <li> <li> <p> Experience with either AWS Azure or Google Cloud and technologies such as Spark Kafka Kubeflow GPU <p> <li> <ul> <h3> <strong> Location <strong> <h3> <p> This role will be and based in the US but is not eligible to be hired in NY WA CT CA and PA <p> <h3> <strong> Travel <strong> <h3> <p> We prioritize connection and opportunities to build relationships with our customers and each other For this role you may be required to travel occasionally to participate in project or team inperson meetings <p> <h3> <strong> What We Offer <strong> <h3> <p> There are many benefits to working at Twilio including in addition to competitive pay things like generous timeoff ample parental and wellness leave healthcare a retirement savings program and much more Offerings vary by location <p> <h3> <strong> Twilio thinks big Do you <strong> <h3> <p> We like to solve problems take initiative pitch in when needed and are always up for trying new things Thats why we seek out colleagues who embody our values something we call <a class=fontbold underline fontbold underline fontbold underline href=httpswwwtwiliocomcompanyvalues rel=noopener noreferrer nofollow target=blank> Twilio Magic <a> Additionally we empower employees to build <a class=fontbold underline fontbold underline fontbold underline href=httpstwilioorgsupportandresourcesimpactfund rel=noopener noreferrer nofollow target=blank> positive change in their communities <a> by supporting their volunteering and donation efforts <p> <p> So if youre ready to unleash your full potential do your best work and be the best version of yourself apply now <p> <p> If this role isnt what youre looking for <a class=fontbold underline fontbold underline fontbold underline href=httpswwwtwiliocomcompanyjobsopenpositions rel=noopener noreferrer nofollow target=blank> please consider other open positions <a> <p> <p> <em> Please note this role is open to candidates outside of Colorado California New York and Washington The information below is provided for candidates hired in those locations only <em> <p> <p> The estimated pay ranges for this role are as follows <p> <ul> <li> <p> Based in Colorado $13500 $169000 <p> <li> <li> <p> This role may be eligible to participate in Twilios equity plan and corporate bonus plan All roles are eligible for the following benefits health care insurance 401k retirement account paid sick time paid personal time off paid parental leave <p> <li> <ul> <p> The successful candidates starting salary will be determined based on permissible nondiscriminatory factors such as skills experience and geographic location within the state <p> <p> <strong> Twilio is proud to be an equal opportunity employer <strong> Twilio is proud to be an Equal Employment Opportunity and Affirmative Action employer We do not discriminate based upon race religion color national origin sex including pregnancy childbirth reproductive health decisions or related medical conditions sexual orientation gender identity gender expression age status as a protected veteran status as an individual with a disability genetic information political views or activity or other applicable legally protected characteristics We also consider qualified applicants with criminal histories consistent with applicable federal state and local law Additionally Twilio participates in the EVerify program in certain locations as required by law <p> <p> Twilio is committed to providing reasonable accommodations for qualified individuals with disabilities and disabled veterans in our job application procedures If you need assistance or an accommodation due to a disability please contact us at accommodationtwiliocom <p><p>

Senior Software Engineer - Ruby on Rails, Backend

Company: Synack

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <p> At Synack we create technology that unleashes the best cybersecurity talent to secure our digital world <p> <p> We protect leading global organizations by reducing companies security risk and increasing their resistance to cyber attack How do we do this By utilizing the worlds best and most trusted team of ethical hackers who test through our powerful and controlled platform to deliver real security without compromise <p> <p> Backed by toptier venture capital firms including Kleiner Perkins Caufield amp Byers Microsoft and Google Ventures Synacks mission is to leverage global security talent coupled with advanced technology to help enterprises discover security vulnerabilities before they become business problems Discover the possibilities at Synack <p> <p> Are you ready to leverage your software development skills to build a platform that is transforming cybersecurity As a Senior Software Engineer Ruby on Rails Backend you will be part of a fastpaced collaborative team developing our cybersecurity platforms You will be a critical contributor to the development of the system while implementing engineering best practices If you enjoy pivoting between different problems and meeting new challenges every day while developing a solution that is mission critical to the organization this role is for you Sounds interesting Keep reading <p> <p> <strong> Please note <strong> This is a remote position based in the US We can only hire US citizens for this position due to federal government contract requirements <p> <p> <p> <p> <strong> Heres what youll do <strong> <p> <ul> <li> <p> Design develop and maintain highly scalable and available microservices hosted on Google Cloud Platform and Azure <p> <li> <li> <p> Collaborate with the product team and engineering leadership in requirements gathering planning and estimation <p> <li> <li> <p> Architect and implement business logic in Ruby on Rails backend and Relational data store <p> <li> <li> <p> Develop and evolve APIs to interface with Web UI <p> <li> <li> <p> Write clean maintainable and efficient code following our coding standards <p> <li> <li> <p> Identify and resolve performance bottlenecks bugs and backend issues <p> <li> <li> <p> Participate in system design code reviews and production releases <p> <li> <li> <p> Contribute to our technical documentation and update system and data flow diagrams as you introduce new features <p> <li> <ul> <p> <strong> Heres what youll need <strong> <p> <ul> <li> <p> 8+ years designing and building dynamic production solutions <p> <li> <li> <p> Solid understanding of objectoriented programming <p> <li> <li> <p> 8+ years in a Ruby on Rails <p> <li> <li> <p> 2+ years experience with building and deploying containerized applications K8s is a bonus <p> <li> <li> <p> Solid backend experience with background jobs processors such as SideKiq <p> <li> <li> <p> Experience with queue and messaging solutions such as PubSubKafka <p> <li> <li> <p> Experience designing and building RESTful APIs <p> <li> <li> <p> Experience with testing tools such as Rspec Jest TestCafe React Testing Library <p> <li> <li> <p> Understanding of various database systems such as RDBMS and NOSQL <p> <li> <li> <p> Experience working with cloud hosted environments <p> <li> <ul> <p> <strong> Great to have <strong> <p> <ul> <li> <p> 2+ years using ReactJSRedux or other JavaScript frameworks and libraries <p> <li> <li> <p> 2+ years of experience with Golang <p> <li> <li> <p> Experience with GCP <p> <li> <li> <p> Experience working in Cyber security problem space <p> <li> <ul> <p> <strong> Ready to join us <strong> <p> <p> Synack is committed to embracing diversity Our people are our strength Each addition to our team is an opportunity to grow and diversify our ideas experiences and viewpoints We strive to be inclusive of Race Ethnicity Religion Sex LGBTQ+ Veterans Disabilities and Age Synack welcomes you <p> <p> As a candidate Synack cares about your privacy Please view our candidate privacy policy <a class=fontbold underline fontbold underline fontbold underline href=httpswwwsynackcomcandidateprivacynotice rel=noopener noreferrer nofollow target=blank> here <a> <p> <p> <strong> $115000 $230000 py <strong> Salary is determined by a combination of factors including location level relevant experience and skills The range displayed on each job posting reflects the minimum and maximum target for new hire salaries for the position across all US locations The compensation package for this position may also include equity and benefits For more details about our benefits please see <a class=fontbold underline fontbold underline fontbold underline href=httpssynackmybenefitslife rel=noopener noreferrer nofollow target=blank> here <a> Then for the Employer code enter <strong> synack <strong> <p><p>

Senior iOS Software Engineer

Company: Empower

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <p> <strong> EMPOWER OVERVIEW <strong> <p> <p> <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpempowerme rel=noopener noreferrer nofollow target=blank> Empower <a> is a highgrowth financial technology company on a mission to expand access to fair credit to give anyone in the world the opportunity to improve their financial security and mobility We dream up and launch oneofakind features that help our members get money instantly whenever they need it save for the future and rewrite their financial story Our members see Empower Cash Advance as a lifesaver Empower Automatic Savings as a gamechanger and the new Empower Thrive line of credit currently in beta launching soon as a lifeline to lowcost borrowing and the only practical path to building good credit <p> <p> <p> <p> Empower is backed by Sequoia Capital Blisce and Icon Ventures Are we the next great place to grow your impact and accelerate your career We think so <p> <p> <p> <p> Inc ranked Empower 56 in the 2023 Inc 5000 list of the fastestgrowing private companies in the US 55 in 2022 Forbes put Empower on its 2023 list of Americas Best Startup Employers Fast Company recognized the new Empower Thrive line of credit in their 2022 list of the Next Big Things in Tech <p> <p> <p> <p> <strong> THE EMPOWER WAY <strong> <p> <p> <strong> Great Expectations <strong> We come up with bold audacious goals for ourselves and go all out for impact <p> <p> <strong> Owner Mindset <strong> We give every employee latitude to act independently make smart choices and move the business forward <p> <p> <strong> Spirited Debate <strong> We love skeptics and seek counter opinions to challenge our personal assumptions and expand our view <p> <p> <strong> Customer Obsession <strong> We listen to understand empathize and create a memorable rewarding experience for our community <p> <p> <strong> Inclusive Collaboration <strong> We believe diverse teams make the best decisions and we strive to give diverse voices a seat at the table <p> <p> N <strong> o Jerks Allowed <strong> We value our relationships and take the time to build trust and connection and communicate respectfully <p> <p> <p> <p> <strong> <strong> <p> <p> <strong> WHAT EMPOWER OFFERS <strong> <p> <p> <p> <p> Competitive salary <p> <p> Generous equity package <p> <p> Full healthcare and dental benefits <p> <p> Technology expense reimbursement <p> <p> Work from anywhere <p> <p> <p> <p> <strong> JOB DESCRIPTION <strong> <p> <p> As an iOS Software Engineer youll create the iOS mobile app that powers the Empower customer experience Youll engage with a collaborative high powered team to develop solutions and lead product engineering on projects with a reach of millions The solutions youll build will be robust secure and easy to understand both for our users and your engineering peers Youll take end to end ownership of new features and product lines shaping work in early stages building deploying and running post deployment analysis to ensure were hitting our goals <p> <p> <p> <p> <p> <p> Travel for company offsites is expected at a minimum 2 times a year <p> <p> <p> <p> <p> <p> <strong> Key Responsibilities <strong> <p> <ul> <li> <p> Designing and building iOS mobile apps <p> <li> <li> <p> Contribution and adherence to software engineering standards and practices <p> <li> <li> <p> Implementing secure coding standards in accordance with the Empower Secure Development Policy <p> <li> <li> <p> Perform ongoing security testing and code review to improve software security <p> <li> <li> <p> Meeting sprint goals <p> <li> <li> <p> Leading andor supporting feature specification activities Product Engineering <p> <li> <li> <p> Monitoring the performance of the Empower mobile app and applying corrective action through bug fixing and general improvement <p> <li> <li> <p> Minimizing defects and improving reliability through Development of automated tests manual test validation development of fit for purpose architecture and code contributing to PRs <p> <li> <li> <p> Developing and maintaining the iOS app build pipeline <p> <li> <li> <p> Publishing the App to the App Store <p> <li> <li> <p> Collaborating crossfunctionally to define design and ship new features that create customer and business value <p> <li> <li> <p> Playing an active role in advising and collaborating with design and product to flesh out the specifications of each epic <p> <li> <li> <p> Writing engineering specs including acceptance criteria and server contracts <p> <li> <li> <p> Grooming stories for upcoming sprints <p> <li> <li> <p> Maximising effective development and identifying new technology opportunities by Keeping across iOS development announcements being across community best practice discovering and evaluating new technologies <p> <li> <ul> <p> <p> <p> <strong> Candidate Qualifications <strong> <p> <ul> <li> <p> Bachelor degree or greater within Computer Science Software Engineering or a related subject <p> <li> <li> <p> 5+ years developing consumer facing iOS apps <p> <li> <li> <p> Working experience in Swift and iOS UI Frameworks <p> <li> <ul> <p> <p> <p> <p> <p> At Empower we hire for people that push themselves to understand others and seek out ways to challenge their personal assumptions Our hope is that by fostering such an environment we strengthen our business and relationships by putting people first We are committed to building a diverse inclusive and equitable workspace where everyone regardless of age education ethnicity gender sexual orientation or any personal characteristics feels like they belong Even if your experience doesnt exactly match up to our job description you should feel empowered to apply regardless <p><p>

Product Design Manager, Tax Credits

Company: Gusto, Inc.

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <p> Product Design at Gusto is made up of over 60 creative collaborative people who care deeply about our mission to empower small businesses and their employees Were a crossfunctional bunch focused on Design Research Writing Ops and Frontend Development who are always looking for opportunities to build understanding and empathy for the people who use Gusto We dont care a whole lot about swim lanes and we work closely with our partners in Product Engineering Data and Marketing to design build and ship experiences that make a difference We are passionate advocates for thoughtful crafted and inclusive experiences and we believe great design can make hard things possible even delightful <a class=fontbold underline fontbold underline fontbold underline href=httpsgustodesignnotionsiteDesignthefutureofworkatGusto1208931e36ae4da399ea4fa43f11b1e1 rel=noopener noreferrer nofollow target=blank> Read more about Design at Gusto <a> <p> <p> <strong> About the team <strong> <p> <p> At Gusto were dedicated to simplifying the complex world of business operations As a powerful People Platform we offer a comprehensive suite of essential products including payroll benefits time tracking and more all designed to streamline processes and empower businesses to thrive Our commitment to worldclass customer experience sets us apart <p> <p> Our Tax Credits team at Gusto is bringing to life an emerging market product for our customers We aim to help guide them through intricate tax credit regulations unlock financial opportunities and extend the runway for their businesses The Tax Credits team has ambitious goals to drastically simplify and demystify the complex world of tax credits in order to drive significant customer value and revenue for our business <p> <p> <strong> About the opportunity <strong> <p> <p> As the Product Design Manager for the Tax Credits team youll lead a small team of product designers to craft high quality and intuitive endtoend experiences for our customers Youll leverage your strategic business acumen to partner with senior crossfunctional leaders to plan and drive the roadmap and multiyear vision The work on Tax Credits is high visibility high impact experiences that balance complex technical and compliance requirements Your leadership will play a pivotal role in simplifying the intricate journey of discovering and securing tax credits ensuring its approachable userfriendly and stressfree <p> <p> <strong> Heres what youll do daytoday <strong> <p> <ul> <li> <p> Develop a deep understanding of the different customers we serve and how their varying needs translate into product requirements <p> <li> <li> <p> Work with crossfunctional partners in Product Management Engineering and Data Science to understand customer problems and identify key opportunities for the customer and our business Youll be the design representative on the senior quartet <p> <li> <li> <p> Empower a small team of product designers creating the conditions for them to do work theyre proud of and that serves the needs of our customers <p> <li> <li> <p> Craft the endtoend journeys and develop frameworks and principles that can be used to help align our teams on the right experiences <p> <li> <li> <p> Collaborate with our Research Data Science and Customer Support teams to build a holistic understanding of customer needs and make sure theyre shared with your teams to inform their thinking build empathy and inform prioritization decisions <p> <li> <li> <p> Collaborate with other key teams and stakeholders at Gusto such as Legal Compliance Risk Operations and other various product owners <p> <li> <li> <p> Ensure that proposed solutions are customerinformed through research data and insights from our Customer Support team <p> <li> <li> <p> Balance an iterative approach and urgency to solve customer pain with ensuring that short term improvements ladder up to longterm vision and meet a high bar for the customer experience <p> <li> <li> <p> Hold high standards for the customer experience including partnering with engineering partners to refine the end customer experience and ensure that what we release is bug free performant accessible and responsive <p> <li> <li> <p> Drive solutions that establish Gusto as a trusted tax expert advisor empowering our customers to make confident and informed tax credit decisions <p> <li> <li> <p> Identify emerging technologies and industry trends build business cases and define product vision and strategy <p> <li> <li> <p> Youll drive teamwide impact through leadership coaching and fostering a culture of growth and collaboration <p> <li> <ul> <p> <strong> Heres what were looking for <strong> <p> <ul> <li> <p> 8+ years Product Design experience with at least 2 of those years being in management roles <p> <li> <li> <p> Ideally youve worked on enabling simple easy to use experiences in complex domains like payroll benefits finance or banking etc Bonus if you have direct experience working on tax andor accounting products <p> <li> <li> <p> A track record of upleveling direct reports and raising the bar for design quality within an organization <p> <li> <li> <p> A proven track record of designing great UX for complex workflows and crafting endtoend experience visions and frameworks while showcasing an iterative approach toward execution <p> <li> <li> <p> A customerfocused mindset and can speak to the impact of the experience theyve shipped in tangible terms the business understands <p> <li> <li> <p> Strong opinions loosely held and a willingness to engage in constructive debates about scope and tradeoffs to build alignment and unblock workYouve built great relationships with cross functional collaborators and know how to model this for your team <p> <li> <li> <p> A proven track record of designing great UX for complex workflows and crafting endtoend experience visions and frameworks while showcasing an iterative approach toward execution <p> <li> <li> <p> A customerfocused mindset and can speak to the impact of the experience theyve shipped in tangible terms the business understands <p> <li> <li> <p> Strong opinions loosely held and a willingness to engage in constructive debates about scope and tradeoffs to build alignment and unblock workYouve built great relationships with cross functional collaborators and know how to model this for your team <p> <li> <li> <p> Communication and collaboration skills that enable you to explain the impact of your work tradeoffs youve made lessons learned and design rationale and generate alignment and enthusiasm across the company <p> <li> <li> <p> Ability to embrace ambiguous situations as opportunities to add clarity <p> <li> <li> <p> A builder who loves being hands on crafting high quality high impact solutions directly and through pairing with more junior team members <p> <li> <ul> <p> At Gusto we strive to provide rewards that empower employees to achieve their financial and personal goals We offer competitive compensation packages with a strong emphasis on equity based compensation ownership in Gusto To learn more about Gustos compensation philosophy and benefits offerings please view our <a class=fontbold underline fontbold underline fontbold underline href=httpsgustocomaboutcareerstotalrewards rel=noopener noreferrer nofollow target=blank> Total Rewards Approach page <a> <p> <p> Our cash compensation range for this role is $152000yr to $232000yr in Denver amp most remote locations and $185000yr to $251000yr in San Francisco amp New York Final offer amounts are determined by multiple factors including candidate experience and expertise and may vary from the amounts listed above <p><p>

Senior Software Engineer - AI

Company: Synack

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <p> At Synack we create technology that unleashes the best cybersecurity talent to secure our digital world <p> <p> We protect leading global organizations by reducing companies security risk and increasing their resistance to cyber attack How do we do this By utilizing the worlds best and most trusted team of ethical hackers who test through our powerful and controlled platform to deliver real security without compromise <p> <p> Backed by toptier venture capital firms including Kleiner Perkins Caufield amp Byers Microsoft and Google Ventures Synacks mission is to leverage global security talent coupled with advanced technology to help enterprises discover security vulnerabilities before they become business problems Discover the possibilities at Synack <p> <p> We are looking for a Senior Software Engineer AI where youll be spearheading the development of cuttingedge AIdriven solutions tailored for the offensive security sector This role demands a handson approach to designing developing and deploying machine learning models that address specific cybersecurity challenges enhancing our product offerings and meeting our customers critical needs Youll lead by example mentoring junior engineers and promoting a culture of technical excellence innovation and continuous improvement <p> <p> Sounds interesting Keep reading <p> <p> <strong> Please note <strong> This is a remote position based in the US We can only hire US citizens for this position due to federal government contract requirements <p> <p> <p> <p> <strong> Heres what youll do <strong> <p> <ul> <li> <p> Design implement and deliver scalable AI and machine learning solutions <p> <li> <li> <p> Develop robust AI models capable of identifying vulnerabilities automating penetration testing processes workflow optimization and enhancing threat intelligence <p> <li> <li> <p> Own and drive the endtoend development of AI product features from ideation to deployment monitoring and model management <p> <li> <li> <p> Actively participate in and contribute to design and implementation of AI solutions promoting best practices during the project lifecycle <p> <li> <li> <p> Lead technical discussions code reviews and design sessions sharing your expertise to uplift the teams capabilities <p> <li> <li> <p> Provide mentorship and support to junior engineers encouraging professional growth and development <p> <li> <li> <p> Collaborate closely with crossfunctional teams to integrate AI capabilities into broader systems and applications <p> <li> <ul> <p> <strong> Heres what youll need <strong> <p> <ul> <li> <p> 10+ years of experience in machine learning engineering with a strong foundation in statistics mathematics or a related field <p> <li> <li> <p> 3+ years of demonstrated experience in designing and implementing machine learning models and data pipelines in production environments <p> <li> <li> <p> Excellent problemsolving skills with the ability to translate complex business requirements into technical solutions <p> <li> <li> <p> Strong communication skills capable of presenting findings and insights to both technical and nontechnical audiences <p> <li> <li> <p> Proficient in Python and strong understanding of AI and machine learning algorithms and frameworks eg Tensorflow PyTorch <p> <li> <li> <p> Strong knowledge of data management systems both SQL eg PostgreSQL and NoSQL egMongoDB <p> <li> <li> <p> Demonstrated ability to work effectively in a teamoriented collaborative environment <p> <li> <ul> <p> <strong> Nice To Have <strong> <p> <ul> <li> <p> Expertise in AI and ML technologies especially Azure AI and Open AI demonstrating the ability to integrate into software solutions <p> <li> <li> <p> Interest or experience in Cyber Security <p> <li> <ul> <p> <strong> Ready to join us <strong> <p> <p> Synack is committed to embracing diversity Our people are our strength Each addition to our team is an opportunity to grow and diversify our ideas experiences and viewpoints We strive to be inclusive of Race Ethnicity Religion Sex LGBTQ+ Veterans Disabilities and Age Synack welcomes you <p> <p> As a candidate Synack cares about your privacy Please view our candidate privacy policy <a class=fontbold underline fontbold underline fontbold underline href=httpswwwsynackcomcandidateprivacynotice rel=noopener noreferrer nofollow target=blank> here <a> <p> <p> <strong> $145000 $235000 py <strong> Salary is determined by a combination of factors including location level relevant experience and skills The range displayed on each job posting reflects the minimum and maximum target for new hire salaries for the position across all US locations The compensation package for this position may also include equity and benefits For more details about our benefits please see <a class=fontbold underline fontbold underline fontbold underline href=httpssynackmybenefitslife rel=noopener noreferrer nofollow target=blank> here <a> Then for the Employer code enter <strong> synack <strong> <p><p>

Principal Engineer

Company: TeamSnap

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <p> <strong> 🌎 About Us <strong> <p> <p> At TeamSnap we believe when the world connects through sports the world becomes better TeamSnap is a sports and communication platform dedicated to taking the work out of play in youth sports We also believe our jobs should excite us our teammates should support us and our bosses should inspire us We empower our people to bring big ideas and tiny egos landing us on Outside Magazines list of <strong> Best Places to Work <strong> and Built Ins <strong> 100 Best RemoteFirst Places to Work <strong> <p> <p> <p> <p> TeamSnap is seeking a Principal Engineer who will report directly to the VP Engineering and Chief Architect to help define lead and drive our technological evolution As a technology leader youll shape our engineering culture in a positive direction with transparency and collaboration by mentoring leading and pairing with teams to evolve their practices and technical vision <p> <p> <p> <p> <p> <p> <strong> What youll be doing <strong> <p> <ul> <li> <p> Execute on the establishment of reference architecture and domain models <p> <li> <li> <p> Influence evolution of developer tooling and experience <p> <li> <li> <p> Help drive the definition of emerging technical and architectural strategies <p> <li> <li> <p> Supporting execution of critical projects via joining scrum teams as an additive team member ensuring the continuity of deliverables beyond scrum team interaction <p> <li> <li> <p> Ensure strong documentation of all systementerprise architecture as well as ancillary collateral such as sequence diagrams eventing orchestration layers and interoperability <p> <li> <li> <p> Define and own core KPIs to track the maintainability and effectiveness of our architecture and technology <p> <li> <li> <p> Encourage innovation creative thought and new ideassolutions <p> <li> <li> <p> Work with department leaders to identify shape and capture strategic technical work <p> <li> <li> <p> Being a strong partner and goto person for all engineering teams <p> <li> <li> <p> Contributing to engineeringwide goals priorities and improvements <p> <li> <li> <p> Consistently and systemically rallying inspiring and empowering all teams to do their best work ever <p> <li> <ul> <p> <p> <p> <strong> Whatll set you up for success <strong> <p> <ul> <li> <p> Experience leading and driving engineering departmentwide change during an evolutionary period of rapid growth and change while serving as a role model for an inclusive engineering culture <p> <li> <li> <p> Experience supporting both product and platform engineering teams as well as familiarity with our tech stack Google Cloud Platform Kubernetes Docker Terraform Datadog Elixir Typescript Golang <p> <li> <li> <p> Experience working across crossfunctional teams to foster a culture of priority setting and urgency in alignment with organizational strategy <p> <li> <li> <p> Deep experience in at least one of the following frontend web architecture mobile development platforms serverless and serverfull hybrid cloud architectures industryleading developer experience automation and tooling <p> <li> <li> <p> Youre comfortable working with nontechnical senior leaders and can convey complex technical topics to them in an approachable manner inviting collaborative discussion while also sweating and diving into the details whenever necessary getting your hands dirty and diving into code with any engineers across our department <p> <li> <li> <p> Ideally you have strong experience at Codenames we play every two weeks <p> <li> <ul> <p> <p> <p> <p> <p> Got cold feet If youre thinking you dont meet 100 of the above qualifications <strong> you should still seriously consider applying <strong> Were all humans with special talents that go beyond whats listed here <p> <p> <p> <p> <strong> Compensation <strong> <p> <p> Were committed to equitable compensation for all TeamSnappers The salary for this role starts at a minimum of $170000 inclusive of bonus and benefits Compensation is adjusted based on work experience skills certifications and geographic location Comp is highly competitive nationwide so please dont hesitate to apply <p> <p> <p> <p> <strong> 🖥 Location <strong> <p> <p> TeamSnap is a fully remote company so you need to be very comfortable working with people who arent in the same time zone as you We are always expanding but there is a small list of states we do not hire in including Alabama Alaska Delaware District of Columbia Hawaii Iowa Louisiana Mississippi Nebraska New Mexico Rhode Island South Dakota and West Virginia and while we love all parts of the world we can only hire permanent US residents at this time <p> <p> <p> <p> <strong> 🚀 Opportunities to Grow <strong> <p> <p> At TeamSnap we work hard to provide a culture of trust accountability inclusivity and boundless opportunities to grow along with the chance to make a lasting impact and have some fun while doing it <p> <p> <p> <p> <strong> 🎩 Total Rewards <strong> <p> <p> Were proud to be <a class=fontbold underline fontbold underline postingslink href=httpswwwinccommattgiventhisstartupceospolicyonworkingremotelyisgeniusanditsbasedonafamoustvshowhtml rel=noopener noreferrer nofollow target=blank> <strong> remotefirst <strong> <a> <strong> <strong> Weve been remote since 2009 long before COVID made it cool <p> <p> Unlimited PTO and paid parental leave for ALL parents not just primary or secondary <p> <p> 100 premium coverage of medicaldentalvision for you and your family <p> <p> 401K to help you invest for the future <p> <p> $1500 annual learning and development stipend <p> <p> Travel to fun locations for allcompany meetings and team events <p> <p> Generous home office allowance to set you up for success <p> <p> TeamSnap SWAG to our <a class=fontbold underline fontbold underline postingslink href=httpsteamlockersquadlockercomlockersteamsnap401580 rel=noopener noreferrer nofollow target=blank> store <a> upon starting and a $50 credit on every work anniversary thereafter <p> <p> A monthly stipend reimbursement for health amp wellness and so much more <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpsdocsgooglecompresentationd1oER8pxhc3zkKRDigScyXd6nQWVNFPV6HwATawDsGhukeditslide=idg22b26eb773f1392 rel=noopener noreferrer nofollow target=blank> TeamSnap Total Rewards <a> <p> <p> <p> <p> 🏆 <strong> Working at TeamSnap <strong> <p> <p> At TeamSnap youre not a culture fit youre a culture add Check out our <a class=fontbold underline fontbold underline postingslink href=httpswwwcanvacomdesignDAE4bjYNX4xtJEKWBDcTWpSARgrKMAoAviewutmcontent=DAE4bjYNX4amputmcampaign=designshareamputmmedium=linkamputmsource=publishsharelink1 rel=noopener noreferrer nofollow target=blank> <strong> Culture Playbook <strong> <a> and learn how we succeed at being remotefirst what makes our company so unique and how were inspired by our people our customers and our values <p> <p> <p> <p> <strong> 🧡 Inclusion and Diversity <strong> <p> <p> Creativity and innovation cant thrive when were cookiecutter images of each other Were quickly growing more diverse but theres always room for improvement We are committed to inclusion and diversity at TeamSnap and we hold ourselves accountable for building an environment where everyone feels valued If you need any disabilityrelated adaptation during the recruitment process just let us know We are an Equal Employment Opportunity Employer <p><p>

Senior Android Software Engineer

Company: Empower

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <p> <strong> EMPOWER OVERVIEW <strong> <p> <p> <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpempowerme rel=noopener noreferrer nofollow target=blank> Empower <a> is a highgrowth financial technology company on a mission to expand access to fair credit to give anyone in the world the opportunity to improve their financial security and mobility We dream up and launch oneofakind features that help our members get money instantly whenever they need it save for the future and rewrite their financial story Our members see Empower Cash Advance as a lifesaver Empower Automatic Savings as a gamechanger and the new Empower Thrive line of credit currently in beta launching soon as a lifeline to lowcost borrowing and the only practical path to building good credit <p> <p> <p> <p> Empower is backed by Sequoia Capital Blisce and Icon Ventures Are we the next great place to grow your impact and accelerate your career We think so <p> <p> <p> <p> Inc ranked Empower 56 in the 2023 Inc 5000 list of the fastestgrowing private companies in the US 55 in 2022 Forbes put Empower on its 2023 list of Americas Best Startup Employers Fast Company recognized the new Empower Thrive line of credit in their 2022 list of the Next Big Things in Tech <p> <p> <p> <p> <strong> THE EMPOWER WAY <strong> <p> <p> <strong> Great Expectations <strong> We come up with bold audacious goals for ourselves and go all out for impact <p> <p> <strong> Owner Mindset <strong> We give every employee latitude to act independently make smart choices and move the business forward <p> <p> <strong> Spirited Debate <strong> We love skeptics and seek counter opinions to challenge our personal assumptions and expand our view <p> <p> <strong> Customer Obsession <strong> We listen to understand empathize and create a memorable rewarding experience for our community <p> <p> <strong> Inclusive Collaboration <strong> We believe diverse teams make the best decisions and we strive to give diverse voices a seat at the table <p> <p> N <strong> o Jerks Allowed <strong> We value our relationships and take the time to build trust and connection and communicate respectfully <p> <p> <p> <p> <strong> <strong> <p> <p> <strong> WHAT EMPOWER OFFERS <strong> <p> <p> <p> <p> Competitive salary <p> <p> Generous equity package <p> <p> Full healthcare and dental benefits <p> <p> Technology expense reimbursement <p> <p> Work from anywhere <p> <p> <p> <p> <strong> JOB DESCRIPTION <strong> <p> <p> As an Android Software Engineer youll create the Android mobile app that powers the Empower customer experience Youll engage with a collaborative high powered team to develop solutions and lead product engineering on projects with a reach of millions The solutions youll build will be robust secure and easy to understand both for our users and your engineering peers Youll take end to end ownership of new features and product lines shaping work in early stages building deploying and running post deployment analysis to ensure were hitting our goals <p> <p> <p> <p> Travel for company offsites is expected at a minimum 2 times a year <p> <p> <p> <p> <p> <p> <strong> Key Responsibilities <strong> <p> <ul> <li> <p> Designing and building Android mobile apps <p> <li> <li> <p> Contribution and adherence to software engineering standards and practices <p> <li> <li> <p> Implementing secure coding standards in accordance with the Empower Secure Development Policy <p> <li> <li> <p> Perform ongoing security testing and code review to improve software security <p> <li> <li> <p> Meeting sprint goals <p> <li> <li> <p> Leading andor supporting feature specification activities Product Engineering <p> <li> <li> <p> Monitoring the performance of the Empower mobile app and applying corrective action through bug fixing and general improvement <p> <li> <li> <p> Minimizing defects and improving reliability through Development of automated tests manual test validation development of fit for purpose architecture and code contributing to PRs <p> <li> <li> <p> Developing and maintaining the Android app build pipeline <p> <li> <li> <p> Publishing the App to the Google Play Store <p> <li> <li> <p> Collaborating crossfunctionally to define design and ship new features that create customer and business value <p> <li> <li> <p> Playing an active role in advising and collaborating with design and product to flesh out the specifications of each epic <p> <li> <li> <p> Writing engineering specs including acceptance criteria and server contracts <p> <li> <li> <p> Grooming stories for upcoming sprints <p> <li> <li> <p> Maximising effective development and identifying new technology opportunities by Keeping across Android development announcements being across community best practice discovering and evaluating new technologies <p> <li> <ul> <p> <p> <p> <strong> Candidate Qualifications <strong> <p> <ul> <li> <p> Bachelor degree or greater within Computer Science Software Engineering or a related subject <p> <li> <li> <p> 5+ years developing consumer facing Android apps <p> <li> <li> <p> Working experience in Kotlin and Android UI Frameworks <p> <li> <ul> <p> <p> <p> <p> <p> At Empower we hire for people that push themselves to understand others and seek out ways to challenge their personal assumptions Our hope is that by fostering such an environment we strengthen our business and relationships by putting people first We are committed to building a diverse inclusive and equitable workspace where everyone regardless of age education ethnicity gender sexual orientation or any personal characteristics feels like they belong Even if your experience doesnt exactly match up to our job description you should feel empowered to apply regardless <p><p>

Account Executive (Manager/Director of Strategic Accounts)

Company: OfferFit

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <p> <strong> Position Overview <strong> <p> <p> Were currently looking for a driven Account Executive ManagerDirector of Strategic Accounts to join our team In this role youll be responsible for winning and growing business for OfferFit by owning new and existing senior customer relationships <p> <p> <strong> In particular you will <strong> <p> <ul> <li> <p> Working closely with our business development amp marketing teams to create leads <p> <li> <li> <p> Lead discussions with potential new OfferFit customers <p> <li> <li> <p> Work with current and future OfferFit customers to determine the highestimpact applications of our AIsolution <p> <li> <li> <p> Participate in OfferFit POV motion to ensure they progress successfully working closely with OfferFits technical Implementation team <p> <li> <li> <p> Build amp own relationships with senior leaders at OfferFits customer companies eg CMOs CIOs <p> <li> <li> <p> Communicate customer needs to OfferFits product amp marketing teams ensuring a customercentric product roadmap <p> <li> <ul> <p> <strong> Why is it great <strong> <p> <ul> <li> <p> Be the face of the company working alongside our customers to help them succeed <p> <li> <li> <p> Sell a product with strong productmarket fit the pain of manual experimentation is a real pain point for marketers leading to a high level of enthusiasm for our products <p> <li> <li> <p> Get strong support from leadership OfferFit prioritizes sales helping your team succeed will be a true priority for the CEO and other Sales leadership team members <p> <li> <li> <p> Lead the AI transformation happening in marketing technology today OfferFit is at the forefront so youll be in the middle of the action <p> <li> <li> <p> Join OfferFits fastpaced supportive and professional team We make sure all of our team members are empowered and receive great mentorship and coaching <p> <li> <ul> <p> <strong> Whos a fit <strong> <p> <ul> <li> <p> Executionfocused leader you can structure a plan align stakeholders and see it through to execution <p> <li> <li> <p> People person you build trustbased relationships with internal team members and external partners and combine empathy with a willingness to have direct challenging conversations <p> <li> <li> <p> Processdriven you can create scalable frameworks to optimize the success of business outcomes <p> <li> <li> <p> Entrepreneurial you take initiative work around obstacles and always seek creative ways to get to the next level <p> <li> <li> <p> Technology enthusiast you are passionate about new technologies and their potential to impact businessasusual <p> <li> <li> <p> Clear communicator you are able to express yourself clearly and persuasively both in writing and speech <p> <li> <li> <p> Sales expert you have a history of enterprise sales and are wellversed in SPIN selling amp MEDDPICC qualification methodology <p> <li> <ul> <p> The base salary range for this position in the United States is $81000$142000 per year plus eligibility for additional commissionbonus ranging $91000$162000 with an overall OTE of $172000$305000 ability to earn more based on sales goals Eligibility for an additional end of year performance bonus commissions when applicable andor equity options may be provided as part of the compensation package in addition to a full range of medical financial andor other benefits depending on the position offered For nonUS based candidates base pay and overall compensation packages will be adjusted based on location Applicants should apply via OfferFits internal or external careers site <p> <p> <strong> OfferFit Benefits and Perks <strong> <p> <ul> <li> <p> Generous PTO starting at 25 days PTO per year and Parental leave policy 12 weeks paid <p> <li> <li> <p> 100 remote work environment with flexible hours <p> <li> <li> <p> Quarterly gatherings where we meet in person in a different city to work together bond as a team and celebrate our progress <p> <li> <li> <p> Weekly team events lunch and learns trivia virtual escape rooms town hall and team health barometer meetings <p> <li> <li> <p> Ability to learn and develop from an experienced leadership team exAmazon McKinsey BCG and IBM among others who are focused on building a talented diverse and inclusive tea <p> <li> <li> <p> Dedication to building a strong culture eg team resource groups weekly recognitions major life event celebrations mental healthsustainability days off etc <p> <li> <li> <p> US Only Competitive benefits major medical vision dental and LTD and 401K matching program <p> <li> <ul><p>

Frequently Asked Questions

What are the typical salary ranges for Competitive Salaries roles by seniority level?
In the U.S., junior-level positions such as Associate Software Engineer or Data Analyst usually earn between $70,000 and $100,000 annually. Mid‑level roles—Senior Engineer, Data Scientist, or Cloud Engineer—typically range from $100,000 to $160,000. Senior and Lead positions, including Principal Engineer or Lead Architect, command $160,000 to $220,000. At the executive tier—VP of Engineering or Chief Data Officer—total compensation often exceeds $250,000, with bonuses and equity pushing the package to $350,000+.
Which technical skills and certifications are most valuable for Competitive Salaries positions?
Key programming languages include Python, Go, Java, and TypeScript. Core frameworks and tools—TensorFlow, PyTorch, Kubernetes, Docker, Terraform, and GitHub Actions—are in high demand. Cloud certifications such as AWS Certified Solutions Architect – Professional, Google Cloud Professional Cloud Architect, and Microsoft Certified: Azure Solutions Architect Expert add significant value. For security roles, CISSP, CISM, and CompTIA Security+ are commonly sought. Additionally, experience with CI/CD pipelines, data lake architecture, and serverless deployment is frequently listed.
Can Competitive Salaries roles be performed remotely, and how common is remote work in this category?
Over 70% of Competitive Salaries listings allow full remote, hybrid, or flexible on‑site arrangements. Tech firms prioritizing distributed teams offer remote‑first policies, while consultancy and regulated industries may require occasional on‑site presence. When applying, check the job description for “remote” or “telecommute” tags and verify that the compensation reflects a comparable market rate.
What career progression paths exist within Competitive Salaries roles?
Typical advancement starts with a Junior or Associate Engineer, moves to Senior Engineer or Data Scientist, then to Lead Engineer, Principal Engineer, or Architect. From there, professionals can transition into managerial tracks—Engineering Manager, Director of Engineering—or into technical leadership—VP of Engineering, Chief Technology Officer. Parallel tracks exist for data science, security, and cloud domains, each with specialized certifications and leadership roles.
What industry trends are driving the demand for Competitive Salaries positions?
Demand is fueled by the rapid adoption of generative AI, large‑language models, and reinforcement learning in product development. Cloud migration to multi‑cloud and edge platforms, the rise of Kubernetes‑native infrastructure, and the shift toward serverless analytics are also expanding opportunities. Cybersecurity remains a top priority as data breaches grow in scale, pushing firms to hire Security Architects and DevSecOps engineers. These trends continually raise the skill bar and the associated compensation.

Related Pages