Flexible Scheduling Jobs in USA
183,459 open positions · Updated daily
Looking for Flexible Scheduling jobs in USA? Browse our curated listings with transparent salary information to find the perfect Flexible Scheduling position in the USA area.
Senior Backend Engineer - Shared Services
Company: Webflow
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> At Webflow our mission is to bring development superpowers to everyone Webflow is the leading visual development platform for building powerful websites without writing code By combining modern web development technologies into one platform Webflow enables people to build websites visually saving engineering time while clean code seamlessly generates in the background From independent designers and creative agencies to Fortune 500 companies millions worldwide use Webflow to be more nimble creative and collaborative Its the web made better <p> <p> We are looking for a Senior Backend Engineer to join the Shared Services team to enable our engineering team to build more efficiently so we can further our mission of bringing visual development superpowers to everyone If youre passionate about engineering excellence and driving operational efficiency wed love to hear from you <p> <h2> <strong> About the role <strong> <h2> <ul> <li> <p> Location Remotefirst United States BC amp ON Canada <p> <li> <li> <p> Fulltime <p> <li> <li> <p> Permanent <p> <li> <li> <p> Exempt <p> <li> <li> <p> The cash compensation for this role is tailored to align with the cost of labor in different geographic markets Weve structured the base pay ranges for this role into zones for our geographic markets and the specific base pay within the range will be determined by the candidates geographic location jobrelated experience knowledge qualifications and skills <p> <ul> <li> <p> United States all figures cited below in USD and pertain to workers in the United States <p> <ul> <li> <p> Zone A $162500 $216050 <p> <li> <li> <p> Zone B $152700 $203100 <p> <li> <li> <p> Zone C $14300 $190150 <p> <li> <ul> <li> <li> <p> Canada All figures cited below in CAD and pertain to workers in ON amp BC Canada <p> <ul> <li> <p> CAD 184600 CAD 245500 <p> <li> <ul> <li> <ul> <li> <li> <p> Please visit our <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowaboutwebflowiocareers rel=noopener noreferrer nofollow target=blank> Careers page <a> for more information on which locations are included in each of our geographic pay zones However please confirm the zone for your specific location with your recruiter <p> <li> <li> <p> Reporting to the engineering manager <p> <li> <ul> <p> As Senior Backend Engineer youll <p> <ul> <li> <p> Develop a comprehensive knowledge of how areas of business such as architecture and infrastructure integrate to improve developer productivity and accomplish our business goals <p> <li> <li> <p> Collaborate with software engineers product managers designers and QA analysts in an autonomous supportive team environment <p> <li> <li> <p> Build and maintain shared services including but not limited to Inapp Email Notification platform and Feature Flag framework <p> <li> <li> <p> Identify develop and document APIs for Webflows service catalog as well as provide quick start guides for developer best practices <p> <li> <li> <p> Solve problems in a highly technical platform that empowers hundreds of engineers <p> <li> <li> <p> Improve our planning development and deployment processes to help you and your fellow team members <p> <li> <li> <p> Mentor coach and inspire a team of engineers of various levels <p> <li> <ul> <p> In addition to the responsibilities outlined above at Webflow we will support you in identifying where your interests and development opportunities lie and well help you incorporate them into your role <p> <h2> <strong> About you <strong> <h2> <p> Youll thrive in this role if you <p> <ul> <li> <p> Have 5+ years developing and deploying web applications with a proven track record of shipping to market <p> <li> <li> <p> Excellent organization and communication skills both verbal and written <p> <li> <li> <p> Have worked on complex issues where the analysis requires an indepth knowledge of the company and existing architecture <p> <li> <li> <p> Can debug production issues across services and multiple levels of the stack <p> <li> <li> <p> Take pride in taking ownership and driving projects to business impact <p> <li> <li> <p> Proven experience building complex web systems <p> <li> <li> <p> Are familiar with one or more Javascript type systems we use TypeScript here <p> <li> <li> <p> Are comfortable working in an agile safetofail environment <p> <li> <ul> <p> <strong> Our Core Behaviors <strong> <p> <ul> <li> <p> <strong> Obsess over customer experience <strong> We deeply understand <em> what <em> were building and <em> who <em> were building for and serving We define the leading edge of whats possible in our industry and deliver the future for our customers <p> <li> <li> <p> <strong> Move with heartfelt urgency <strong> We have a healthy relationship with impatience channeling it thoughtfully to show up better and faster for our customers and for each other Time is the most limited thing we have and we make the most of every moment <p> <li> <li> <p> <strong> Say the hard thing with care <strong> Our best work often comes from intelligent debate critique and even difficult conversations We speak our minds and dont sugarcoat things and we do so with respect maturity and care <p> <li> <li> <p> <strong> Make your mark <strong> We seek out new and unique ways to create meaningful impact and we champion the same from our colleagues We work as a <em> team <em> to get the job done and we go out of our way to celebrate and reward those going above and beyond for our customers and our teammates <p> <li> <ul> <h3> <strong> Benefits amp wellness <strong> <h3> <ul> <li> <p> Equity ownership RSUs in a growing privatelyowned company <p> <li> <li> <p> 100 employerpaid healthcare vision and dental insurance coverage for employees and dependents fulltime employees working 30+ hours per week as well as Health Savings AccountHealth Reimbursement Account dependent care Flexible Spending Account US only dependent on insurance plan selection where applicable in the respective country of employment Employees may also have voluntary insurance options such as life disability hospital protection accident and critical illness where applicable in the respective country of employment <p> <li> <li> <p> 12 weeks of paid parental leave for both birthing and nonbirthing caregivers as well as an additional 68 weeks of pregnancy disability for birthing parents to be used before child bonding leave where local requirements are more generous employees receive the greater benefit Employees also have access to family planning care and reimbursement <p> <li> <li> <p> Flexible PTO with a mandatory annual minimum of 10 days paid time off for all locations where local requirements are more generous employees receive the greater benefit and sabbatical program <p> <li> <li> <p> Access to mental wellness and professional coaching therapy and Employee Assistance Program <p> <li> <li> <p> Monthly stipends to support health and wellness smart work and professional growth <p> <li> <li> <p> Professional career coaching internal learning amp development programs <p> <li> <li> <p> 401k plan and pension schemes in countries where statutorily required financial wellness benefits like CPA or financial advisor coverage <p> <li> <li> <p> Discounted Pet Insurance offering US only <p> <li> <li> <p> Commuter benefits for inoffice employees <p> <li> <ul> <h3> <strong> Be you with us <strong> <h3> <p> At Webflow equality is a core tenet of our culture We are an Equal Opportunity EEOVeteransDisabled Employer and are <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomdiversityequityinclusion rel=noopener noreferrer nofollow target=blank> committed <a> to building an inclusive global team that represents a variety of backgrounds perspectives beliefs and experiences Employment decisions are made on the basis of jobrelated criteria without regard to race color religion sex sexual orientation gender identity national origin disability veteran status or any other classification protected by applicable law Pursuant to the San Francisco Fair Chance Ordinance Webflow will consider for employment qualified applicants with arrest and conviction records <p> <h3> <strong> Stay connected <strong> <h3> <p> Not ready to apply but want to be part of the Webflow community Consider following our story on our <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomblog rel=noopener noreferrer nofollow target=blank> Webflow Blog <a> <a class=fontbold underline fontbold underline fontbold underline href=httpswwwlinkedincomcompanywebflowinc rel=noopener noreferrer nofollow target=blank> LinkedIn <a> <a class=fontbold underline fontbold underline fontbold underline href=httpstwittercomwebflow rel=noopener noreferrer nofollow target=blank> X Twitter <a> andor <a class=fontbold underline fontbold underline fontbold underline href=httpswwwglassdoorcomReviewsWebflowReviewsE890506htm rel=noopener noreferrer nofollow target=blank> Glassdoor <a> <p> <h3> <strong> Please note <strong> <h3> <p> <em> To join Webflow youll need valid US or Canadian work authorization depending on the country of employment <em> <p> <p> <em> If you are extended an offer that offer may be contingent upon your successful completion of a background check which will be conducted in accordance with applicable laws We may obtain one or more background screening reports about you solely for employment purposes <em> <p> <p> <em> For information about how Webflow processes your personal information please review <em> <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomlegalapplicantprivacynotice rel=noopener noreferrer nofollow target=blank> <em> Webflows Applicant Privacy Notice <em> <a> <em> <em> <p> <p> <p><p>
Director - Corporate FP&A
Company: Icertis
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> With unmatched technology and categorydefining innovation Icertis pushes the boundaries of whats possible with contract lifecycle management CLM The AIpowered analystvalidated Icertis Contract Intelligence ICI platform turns contracts from static documents into strategic advantage by structuring and connecting the critical contract information that defines how an organization runs Today the worlds most iconic brands and disruptive innovators trust Icertis to fully realize the intent of their combined 10 million contracts worth more than $1 trillion in 40+ languages and 93 countries <p> <p> <p> <p> <strong> Who we are <strong> Icertis is the only contract intelligence platform companies trust to keep them out in front now and in the future Our unwavering commitment to contract intelligence is grounded in our FORTE valuesFairness Openness Respect Teamwork and Executionwhich guide all our interactions with employees customers partners and stakeholders Because in our mission to be the contract intelligence platform of the world we believe how we get there is as important as the destination <p> <p> <p> <p> As the Director of FPampA you will play a critical leadership role you will work closely with all of companys functional leaders and bring key market strategic and operational insights that will shape the direction of the company and accelerate its growth You will also play a key role in telling the companys financial story to investors <p> <p> <p> <p> The ideal candidate will have a proven trackrecord of driving business outcomes through keen financial insight and business modeling They will have the ability to create a 360degree financial picture of the business that reflects and influences the companys strategy and be excellent at communicating with senior leaders and executives They will be toolsavvy with experience in creating scalable data and reporting solutions that support a datadriven culture LIRS1 <p> <p> <p> <p> <p> <p> <strong> What you will do <strong> <p> <ul> <li> <p> Formulate a robust 360degree financial picture of the business complete with market insights and operational drivers <p> <li> <li> <p> Develop and maintain the 3year Strategic Planning Model and forecast <p> <li> <li> <p> Deliver Global PampL and cash flow forecasts <p> <li> <li> <p> Drive Annual Planning Process work cross functionally to build and maintain the Annual Financial Plan and Departmental Budgets <p> <li> <li> <p> Build and deliver Business Performance ReportingOperating dashboards <p> <li> <li> <p> Perform strategic business analysis as needed MampA Geo Expansion <p> <li> <li> <p> Prepare financial analyses as needed to help drive improvements in the business Current focus areas include market expansion opportunities competitive benchmarking analyses pricing and strategic financial optimization strategies <p> <li> <li> <p> Partner with Controller to enhance and accelerate the financial reporting process <p> <li> <li> <p> Identifies and implements system and process improvements to increase the efficiency and effectiveness of planning and reporting workflows <p> <li> <li> <p> Prepare communications to Board of Directors <p> <li> <li> <p> Drive investor presentations and supporting analysis <p> <li> <li> <p> Develop a deep understanding of the business metrics with an eye towards understanding the benefits and risks from a financial perspective and helping to manage key business drivers and desired outcomes <p> <li> <li> <p> Play a key role in preparation of critical public financial documents to support the IPO process including working with bankers and supporting the production of investor materials and SEC filings eg S1 <p> <li> <ul> <p> <p> <p> <strong> What you will bring <strong> <p> <ul> <li> <p> 12+ years of experience of working in direct strategic analysis support of all aspects of the business at all areas of the PampL <p> <li> <li> <p> MBACPA or equivalent experience preferred <p> <li> <li> <p> Demonstrated complex modeling experience this is a handson role and managers are expected to directly contribute and lead by example <p> <li> <li> <p> Highly analytical detailoriented with a commitment to creating a highquality product Naturally inquisitive and able to extract information from various sources to identify and understand the underlying issue Not afraid to question results <p> <li> <li> <p> Prior success working in a fastpaced entrepreneurial environment takes initiative and works independently <p> <li> <li> <p> Working knowledge of accounting principles required including revenue recognition amortization and accrual vs cash accounting Must have a general understanding of financial statements <p> <li> <li> <p> Must have exceptional written visual and spoken communication skills <p> <li> <li> <p> Experience in preparing and delivering executive board and investor level communications <p> <li> <li> <p> IPO experience is a plus <p> <li> <li> <p> Must have advanced Excel Netsuite and Powerpoint skills <p> <li> <li> <p> Experience implementing financial analysis and planning tools required <p> <li> <ul> <p> <p> <p> <p> <p> $146000 $219000 a year <p> <p> <em> Pay offered will vary based on jobrelated factors such as location experience training skills and abilities In addition to the base salary and annual bonus target and an equity component is included in the compensation package <em> <p> <p> <strong> What we offer <strong> <p> <p> We are committed to the health and wellbeing of all Icertians their families the communities they live in and our customers This commitment is represented in the Icertis Four Rings of Responsibility Take Care of Self Take Care of Family Take Care of Community and Take Care of Business in that order <p> <p> <p> <p> To support these commitments Icertis offers excellent health and welfare benefits a generous 401k match and a robust paid time off program Here are some of the other reasons <a class=fontbold underline fontbold underline postingslink href=httpswwwicertiscomcompanynewsicertisplacesfirstinwashingtons100bestcompaniestoworkfor rel=noopener noreferrer nofollow target=blank> Icertis Places First in Washingtons 100 Best Companies to Work For | Icertis <a> <p> <p> <p> <p> ● Equity RSUs and shared ownership in the company <p> <p> ● Flexible work environment <p> <p> ● Paid maternity and paternity leave <p> <p> ● 7 Days for Humanity 7 paid volunteer days <p> <p> ● Generous holidays including the 4th of July week off paid <p> <p> ● Free professional and leadership coaching <p> <p> ● Annual personal development allowance <p> <p> <p> <p> Icertis Inc provides Equal Employment Opportunity to all employees and applicants for employment without regard to race color religion gender identity or expression sex sexual orientation national origin age disability genetic information marital status amnesty or status as a covered veteran in accordance with applicable federal state and local laws Icertis Inc complies with applicable state and local laws governing nondiscrimination in employment in every location in which the company has facilities If you are in need of accommodation or special assistance to navigate our website or to complete your application please send an email with your request to <a class=fontbold underline fontbold underline postingslink href=mailtocareersicertiscom rel=noopener noreferrer nofollow target=blank> careersicertiscom <a> or get in touch with your recruiter <p> <p> <p> <p> By submitting your application you acknowledge that you have read Icertiss Privacy Policy <a class=fontbold underline fontbold underline postingslink href=httpswwwicertiscomprivacystatement rel=noopener noreferrer nofollow target=blank> httpswwwicertiscomprivacystatement <a> <p> <p> <p> <p> Icertis is not open to third party solicitation or resumes for our posted FTE positions Resumes received from third party agencies that are unsolicited will be considered complimentary <p><p>
Senior Software Engineer
Company: Superhuman
Location: USA
Posted Apr 29, 2024
<p class=jobDescription> <h2> <strong> SUPERHUMAN 👉 <strong> <h2> <ul> <li> <p> The fastest email experience in the world <p> <li> <li> <p> Loved and adored <a class=fontbold underline fontbold underline fontbold underline href=httpssuperhumancomlove rel=noopener noreferrer nofollow target=blank> see what our customers say <a> <p> <li> <ul> <p> Our customers get through their inboxes twice as fast many see inbox zero for the first time in years <p> <p> Come shape the future of email communication and productivity <p> <h2> <strong> BUILD LOVE 💜 <strong> <h2> <p> At Superhuman we deeply understand <a class=fontbold underline fontbold underline fontbold underline href=httpsblogsuperhumancomgamedesignnotgamification rel=noopener noreferrer nofollow target=blank> how to build products that people love <a> We incorporate fun and play we infuse magic and joy we make experiences that amaze and delight <p> <p> It all starts with the right team a team that deeply cares about values customers and each other <p> <h2> <strong> CREATE MASSIVE IMPACT 🚀 <strong> <h2> <p> Were not solving a small problem and were not addressing a small market Were going after email the one activity that consumes more of our work day than any other <p> <p> Our ambition doesnt stop there Next calendars notes contacts and tasks We are building the productivity platform of the future <p> <h2> <strong> DO THE BEST WORK OF YOUR LIFE 🌟 <strong> <h2> <p> We have created the frameworks for how to build product market fit and redefined the narrative of how to onboard customers successfully We have shown the world its possible to build a premium productivity brand Our investors include Andreessen Horowitz First Round Capital IVP Tiger Global Management Sam Altman and the founders of Gmail Dropbox Reddit Discord Stripe GitHub AngelList and Intercom <p> <p> Our latest financing was led by IVP and we welcomed Ajay Vashee to our board Our prior financing was led by Andreessen Horowitz and we welcomed Marc Andreessen and David Ulevitch to our board <p> <p> This time were swinging beyond the fences and <a class=fontbold underline fontbold underline fontbold underline href=httpswwwivpcomnewsblogsuperhumanreimaginingworkplacecommunication rel=noopener noreferrer nofollow target=blank> fundamentally rethinking how individuals and teams should collaborate <a> We are building a household brand and a worldwide organization We are here to do the best work of our lives and we hope you are too <p> <h2> <strong> ROLE 👩🏽💻👨💻 <strong> <h2> <ul> <li> <p> Successfully implement Calendar features that enhance user experience and drive user engagement <p> <li> <li> <p> Contribute to the product development process thinking through UX designing beautiful UI and working with customers to solve their problems <p> <li> <li> <p> Help estimate plan and complete projects features and integrations <p> <li> <li> <p> Champion code quality new technologies and architectural design within the company <p> <li> <li> <p> Technologies we use React Golang Postgres Electron Google Cloud <p> <li> <ul> <h2> <strong> SOUND LIKE YOU 🙌 <strong> <h2> <ul> <li> <p> <strong> Experience <strong> You have 5+ years of software engineering experience <p> <li> <li> <p> <strong> Technical Skills <strong> Youre an expert in frontend technologies such as Javascript or Typescript You have a strong foundation in software engineering principles that prioritize highquality maintainable code that adheres to best practices <p> <p> Youre able to identify problems propose solutions and make informed decisions to drive forward our technical efforts Youre comfortable dealing with ambiguity and can think critically to make decisions that benefit the company and our users <p> <li> <li> <p> <strong> Remarkable Quality <strong> You produce work that is striking worthy of attention and a contribution to the state of the art <p> <li> <li> <p> <strong> Asynchronous Communicator <strong> Youre effective across various mediums especially Slack Notion and email and can produce and consume detailed written materials as needed without sacrificing speed You respond quickly and thoughtfully to unblock others and speed things up <p> <li> <li> <p> <strong> StarttoFinish Ownership <strong> You act with 100 responsibility for your own outcomes as well as the outcomes of the company You discuss and debates ideas openly You focus on the customer and business so what and challenge stakeholders to take impactful action <p> <li> <li> <p> <strong> Bias to action <strong> Speed matters You take rapid and decisive steps forward even in the face of uncertainty and recognize that action is the catalyst for progress and growth <p> <li> <li> <p> <strong> Location <strong> Were open to you joining us in our San Francisco office or from a home office anywhere in North or South America <p> <li> <ul> <h2> <strong> SALARY INFO 💸 <strong> <h2> <p> The Software Engineer Calendar role spans several internal levels and a wide breadth of experience at Superhuman Our compensation band reflects the potentially broad range of candidates and experience levels that we are open to hiring for this role <p> <p> Our starting salaries for this role range from $165000 $185000 The salary range does not reflect total compensation which includes base salary benefits and company stock options <p> <p> We are open to candidates in the US Canada or Latin America We take a locally informed approach to nonUSbased compensation and will be able to share ranges based on your country of residence <p> <h2> <strong> BENEFITS 🎁 <strong> <h2> <p> <strong> Taking Care of Your Future 🙏 <strong> <p> <ul> <li> <p> Medical dental and vision insurance 100 coverage for you and 75 coverage for all your dependents <p> <li> <li> <p> Voluntary insurance shortterm disability longterm disability and life insurance <p> <li> <li> <p> 401k plan we match 75 cents per dollar up to 4 of your salary <p> <li> <li> <p> Free access to Northstar a financial wellness platform that provides financial advisors + personal finance tools <p> <li> <ul> <p> <strong> Generous Time Off 🏝 <strong> <p> <ul> <li> <p> Enjoy our generous and flexible Paid Time Off PTO policy with our amazing team members taking an average of 20 days per year <p> <li> <li> <p> 13 additional company holidays plus your own Care Days Flexible Holidays and a companywide Winter Break <p> <li> <li> <p> Generous parental caregiver healthcare and compassionate leave policies <p> <li> <ul> <p> <strong> Investing in Your Growth ✍️ <strong> <p> <ul> <li> <p> $3000 per year towards your professional development <p> <li> <li> <p> Free access to Calm and Taskhuman <p> <li> <li> <p> Allyship education program to help build your best self <p> <li> <ul> <p> <strong> Setting You Up For Success 🧑🏻💻👩🏾💻 <strong> <p> <ul> <li> <p> Custom MacBook Pro <p> <li> <li> <p> $1000 budget for workstation setup <p> <li> <li> <p> $260month for your lunches groceries or whatever nutrition you need to stay fueled up <p> <li> <li> <p> Flexible spending accounts for commuter costs dependent care and healthcare expenses <p> <li> <ul> <p> At Superhuman we value diversity We are an equal opportunity employer we do not discriminate on the basis of race religion color national origin gender sexual orientation age marital status veteran status or disability status <p> <p> <p><p>
Recruiting Coordinator
Company: User Interviews
Location: USA
Posted Apr 29, 2024
<p class=jobDescription> <p> <strong> 🤠 Why Join Us <strong> <p> <p> User Interviews is a fully remote team and always has been We are proactive about staying connected to each other despite not sharing the same physical space Remote culture is real and we care about ita lot Were a team of doers Youll be fully supported by your manager and team but there wont be anyone peering over your shoulder Youll be expected and trusted to take ownership of your work and to communicate clearly and transparently with your distributed teammates On a related note were very profeedback From our users of course But also from each other From individual contributors right up to the CEO this is a team that is genuinely committed to continuous improvement <p> <p> <strong> ⭐️ About User Interviews <strong> <p> <p> At User Interviews we believe that the best companies in the world consistently deliver products and experiences that their customers love We also believe that the only way to consistently build those products and experiences is to talk to your customers Watch what they do Understand why they do what they do Figure out why they do things that seem irrational And once youve done that once do it again Start having constant conversations In short make customers your 1 priority through user research Thats why we exist We help teams set up those conversations that research allowing them to discover and embrace user insights We specialize in participant recruitment and management because you cannot do good research without good participants no matter how good your other tools may be We work with hundreds of companies every month including usercentric organizations like Atlassian Amazon and Spotify <p> <p> <strong> 📝 About The Role ➡️ THIS IS A TEMPORARY FULLTIME 6 MONTH CONTRACT POSITION ⬅️ <strong> <p> <p> Our People and Talent Team plays a crucial role in attracting and nurturing exceptional talent which is vital to our ambitious growth objectives As our new Recruiting Coordinator you will be a key part of our candidatefocused strategy Working closely with the Talent Acquisition Manager you will help coordinate and deliver an outstanding recruitment experience ensuring we continue to attract topnotch talent <p> <p> <p> <p> <strong> 🎯 What Youll Achieve <strong> <p> <ul> <li> <p> 🌟 <strong> Kickstart Incredible Candidate Journeys <strong> Youll be at the forefront setting the initial impression for potential new hires In collaboration with our Talent Acquisition Manager and various teams youll sprinkle some magic into our recruitment process Your goal is to make every candidate feel the excitement about who we are as a company and eager to join us <p> <li> <li> <p> 📅 <strong> Scheduling Maestro <strong> You have a talent for organization and will elevate interview scheduling to an art form even in a remote setting Your role ensures that every virtual interview is prompt polite and perfectly aligned with our objectives contributing to our smooth and impressive growth trajectory Youll manage time zones digital platforms and all the details that make remote interviews as seamless and engaging as inperson ones <p> <li> <li> <p> 🚀 <strong> Embrace the Adventure <strong> Prepare for a dynamic six months of accelerated growth where every day brings something new If you thrive on tackling new challenges and gaining momentum along the way this is the place for you Were all about moving quickly learning quickly and achieving big <p> <li> <li> <p> 🤝 <strong> Build Bridges <strong> You will be the key connector linking candidates hiring managers and interview teams With your clear warm and engaging communication youll ensure everyone is informed and feels positive about the recruitment process See yourself as the friendly face that transforms recruiting from a routine process into a collaborative team effort seamlessly bridging distances and bringing people together digitally <p> <li> <li> <p> 🛠 <strong> Craft the Journey from Start to Finish <strong> Youre involved in every step of the recruitment process from posting the job to making the hire Your responsibilities include resume review sourcing candidates interview scheduling and conducting some initial candidate screenings Your aim is to keep us responsive and ready for whats next ensuring a seamless transition as candidates are passed over to the People side of our team for onboarding Your efforts guarantee that every stage of the recruitment and hiring process flows smoothly setting the stage for a successful integration into our team <p> <li> <ul> <p> <strong> 🤩 The Skills Youll Need to Shine <strong> <p> <ul> <li> <p> <strong> Emerging Recruiting Talent <strong> With at least 12 months of experience in recruiting coordination including tech and nontech roles youre adept at managing the complexities of remote interview setups <p> <li> <li> <p> <strong> Organizational Wizard <strong> Your superpower is managing tasks priorities and deadlines with ease keeping everything and everyone aligned especially in fastpaced environments <p> <li> <li> <p> <strong> Team Cheerleader <strong> Known for your kindness warmth and thoughtfulness you excel at representing our company positively at every stage of the candidate experience <p> <li> <li> <p> <strong> Detail Dynamo <strong> You have a keen eye for detail ensuring nothing is overlooked while balancing speed with precision <p> <li> <li> <p> <strong> Champion of Service and Growth <strong> Dedicated to exceptional service and continuous improvement youre always looking for ways to enhance our operations <p> <li> <ul> <p> <p> <p> <strong> 💪 Would Be Awesome to Have <strong> <p> <ul> <li> <p> <strong> Tech Tools Maestro <strong> Experience using Greenhouse LinkedIn Recruiter and Notion is music to our ears These tools are our daily companions and your familiarity with them means we can move faster and more effectively from day one <p> <li> <li> <p> <strong> Startup Spirit <strong> If youve thrived in the fastpaced everchanging environment of a highgrowth company or startup you know exactly the kind of agility and resilience we admire This experience is incredibly valuable offering insights into thriving amidst rapid scaling and evolving challenges <p> <li> <ul> <p> <p> <p> <strong> 🤑 Benefits <strong> <p> <p> Hourly pay of $3125 $3400 dependent on experience 100 premium covered medical + dental employee coverage Annual membership to One Medical Group amp Talkspace Accrued paid sick leave 1 hour of paid sick leave for every 40 hours worked $250 office setup stipend in addition to computer being provided $50month work from home stipend $100 annual learning amp development stipend Awards for 360degree recognition work anniversaries amp birthdays <p> <p> <strong> 💚 We embrace what makes you you <strong> We are committed to accessibility equity diversity and inclusion We build products for and welcome participants researchers and employees from a diverse set of backgrounds These backgrounds includebut are not limited tovaried socioeconomic status gender identity or expression sexual orientation religion race ethnicity age neurodivergence disability and citizenship As we grow we are aware that this work is continuous We will not settle for how things are but rather strive for how they could be <p> <p> <p><p>
Brand Designer
Company: Modern Health
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <h2> The Role <h2> <p> Are you an ambitious creative professional Does joining a rapidlygrowing tech company in the health and mental wellbeing space sound exciting The Marketing team at Modern Health is hiring a Brand Designer to help build our brand identity as we expand executing a wide range of projects including web content email newsletters videos advertising conference materials sales presentations onesheeters and much more You will be a key member of the Marketing team collaborating across product customer success clinical care and recruiting to build a cohesive elevated brand for Modern Health and to ensure specific messages are being visually conveyed through your designs <p> <p> This position is not eligible to be performed in Hawaii <p> <h2> <strong> What Youll Do <strong> <h2> <ul> <li> <p> Manage project request intake and scope clarification <p> <li> <li> <p> Design and development of marketing materials including website pages presentations print and digital advertising conference materials research reports social media campaigns onesheeters postcards promotions videos webinars and other marketing collateral <p> <li> <li> <p> Collaborate with other marketing and product team members to ensure quality and consistency in all aspects of our brand presence <p> <li> <li> <p> Provide status updates and juggle multiple projectswere an agile team with shifting priorities <p> <li> <li> <p> Become an informed and vocal advocate of great design at Modern Health <p> <li> <ul> <h2> <strong> Who You Are <strong> <h2> <ul> <li> <p> 3+ years of design experience in a fastpaced highgrowth environment <p> <li> <li> <p> MUST have an online portfolio of relevant work examples <p> <li> <li> <p> Handson experience with Figma Adobe Creative Suite including Photoshop and llustrator <p> <li> <li> <p> Use of MS Office and Google Docs and how those are used crossfunctionally with Adobe CS <p> <li> <li> <p> Experience working with web developer to develop website pages <p> <li> <li> <p> Knowledge of how to prepare files for optimal online use and print bleed areas CMYK Pantone RGB etc <p> <li> <li> <p> Understand the different pixel resolutions required for print and online <p> <li> <li> <p> Experience working within existing brand guidelines andor designing new brand guidelines <p> <li> <li> <p> Must be highly detail oriented and selfmotivated and able to prioritize your workload to meet critical deadlines <p> <li> <li> <p> Able to work well independently as well as under the direction of others <p> <li> <li> <p> Coachable and values constructive criticism from a variety of sources <p> <li> <li> <p> Excellent written and verbal communication skills <p> <li> <li> <p> Curious creative flexible proactive and ambitious <p> <li> <ul> <h2> <strong> Benefits <strong> <h2> <p> Fundamentals <p> <ul> <li> <p> Medical Dental Vision Disability Life Insurance <p> <li> <li> <p> High Deductible Health Plan with Health Savings Account HSA option <p> <li> <li> <p> Flexible Spending Account FSA <p> <li> <li> <p> Access to coaches and therapists through Modern Healths platform <p> <li> <li> <p> Generous Time Off <p> <li> <li> <p> Companywide Collective Pause Days <p> <li> <ul> <p> Family Support <p> <ul> <li> <p> Parental Leave Policy <p> <li> <li> <p> Family Forming Benefit through Carrot <p> <li> <li> <p> Family Assistance Benefit through UrbanSitter <p> <li> <ul> <p> Professional Development <p> <ul> <li> <p> Professional Development Stipend <p> <li> <ul> <p> Financial Wellness <p> <ul> <li> <p> 401k <p> <li> <li> <p> Financial Planning Benefit through Origin <p> <li> <ul> <p> But wait theres more <p> <ul> <li> <p> Annual Wellness Stipend to use on items that promote your overall well being <p> <li> <li> <p> New Hire Stipend to help cover workfromhome setup costs <p> <li> <li> <p> ModSquad Community Virtual events like active ERGs holiday themed activities teambuilding events and more <p> <li> <li> <p> Monthly Cell Phone Reimbursement <p> <li> <ul><p>
Sales Account Executive
Company: Milk Stork
Location: USA
Posted Apr 30, 2024
Milk Stork is seeking a Sales Account Executive for a remote, full-time position. The role involves driving the company's mission forward by engaging with enterprise clients to expand access to their solutions. The ideal candidate will have 4+ years of proven experience in B2B/SaaS sales, excellent communication skills, and the ability to work independently in a remote startup environment. The company offers competitive compensation, excellent benefits, and a flexible work culture.
Enterprise Account Manager
Company: Pagerduty
Location: USA
Posted Apr 29, 2024
PagerDuty is seeking an Enterprise Growth Account Executive with experience selling SaaS products to Enterprise accounts. The role involves leading and managing a pipeline of opportunities within existing accounts to deliver results against sales targets. The ideal candidate should have a consultative sales approach, a proven knack for driving sales growth, and the ability to captivate a tech-savvy audience. Key responsibilities include value selling, sales effectiveness, and sales execution. The base salary range for this position is 130,000 - 140,000 USD. PagerDuty offers a comprehensive total rewards approach, including competitive salary, comprehensive benefits, flexible work arrangements, and more.
Software Engineer - Seller Experience
Company: Whatnot
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <h2> <strong> 🚀 Whatnot <strong> <h2> <p> Whatnot is a livestream shopping platform and marketplace backed by Andreessen Horowitz Y Combinator and CapitalG Were building the future of ecommerce bringing together community shopping and entertainment We are committed to our <a class=fontbold underline fontbold underline fontbold underline href=httpswwwwhatnotcomcareers rel=noopener noreferrer nofollow target=blank> values <a> and as a remotefirst team we operate out of hubs within the US Canada UK Ireland and Germany today <p> <p> Were innovating in the fastpaced world of live auctions in categories including sports fashion video games and streetwear The platform couples rigorous seller vetting with a focus on community to create a welcoming space for buyers and sellers to share their passions with others <p> <p> And were growing Whatnot has been the <a class=fontbold underline fontbold underline fontbold underline href=httpsa16zcommarketplace100 rel=noopener noreferrer nofollow target=blank> fastest growing marketplace <a> in the US over the past two years and were hiring forwardthinking problem solvers across all functional areas <p> <h2> <strong> 💻 Role <strong> <h2> <p> The Seller Experience team plays a crucial role in empowering our community of sellers with tools and experiences that allow them to succeed and grow on Whatnot You will be at the forefront of developing scalable user friendly solutions that enhance the seller journey at every step of the lifecycle from onboarding scaling and growth The problems you will tackle span from Casual Resellers to Large Retailers <p> <h2> <strong> 👋 You <strong> <h2> <p> Curious about who thrives at Whatnot Weve found that low ego a growth mindset and leaning into action and high impact goes a long way here <p> <p> As our next Software Engineer you should have 5+ years of generalist software engineering experience at a fast growing technology company plus <p> <ul> <li> <p> We primarily use Python JavaScript Elixir and are open to others <p> <li> <li> <p> Excellent product instincts You first think about users rather than the best technical solution <p> <li> <li> <p> You are known for shipping products and features lightningfast <p> <li> <li> <p> Youre an excellent problem solver and dont need to be told exactly what to do <p> <li> <li> <p> Comfortable working across the stack backend and frontend <p> <li> <li> <p> Ability to pick up on new technologies very quickly <p> <li> <li> <p> Proven track record of delivering features <p> <li> <li> <p> Bonus Experience building technology in ecommerce contributing to seller experiences and success <p> <li> <ul> <h2> <strong> 💰Compensation <strong> <h2> <p> For USbased applicants <strong> <strong> $178000year to $235000year + benefits + stock options <p> <p> The salary range may be inclusive of several levels that would be applicable to the position Final salary will be based on a number of factors including level relevant prior experience skills and expertise This range is only inclusive of base salary not benefits more details below or equity in the form of stock options <p> <h2> <strong> 🎁 Benefits <strong> <h2> <ul> <li> <p> Flexible Time off Policy and Companywide Holidays including a spring and winter break <p> <li> <li> <p> Health Insurance options including Medical Dental Vision <p> <li> <li> <p> Work From Home Support <p> <ul> <li> <p> $1000 home office setup allowance <p> <li> <li> <p> $150 monthly allowance for cell phone and internet <p> <li> <ul> <li> <li> <p> Care benefits <p> <ul> <li> <p> $450 monthly allowance on food <p> <li> <li> <p> $500 monthly allowance for wellness <p> <li> <li> <p> $5000 annual allowance towards Childcare <p> <li> <li> <p> $20000 lifetime benefit for family planning such as adoption or fertility expenses <p> <li> <ul> <li> <li> <p> Retirement 401k offering for Traditional and Roth accounts in the US employer match up to 4 of base salary and Pension plans internationally <p> <li> <li> <p> Parental Leave <p> <ul> <li> <p> 16 weeks of paid parental leave + one month gradual return to work company leave allowances run concurrently with country leave requirements which take precedence <p> <li> <ul> <li> <ul> <h2> <strong> 💛 EOE <strong> <h2> <p> Whatnot is proud to be an Equal Opportunity Employer We value diversity and we do not discriminate on the basis of race religion color national origin gender sexual orientation age marital status veteran status parental status disability status or any other status protected by local law We believe that our work is better and our company culture is improved when we encourage support and respect the different skills and experiences represented within our workforce <p><p>
Backend Engineer
Company: Trufflesecurity
Location: USA
Posted Apr 30, 2024
Truffle Security Co is seeking a passionate Software Engineer with experience in Go, gRPC, and K8s to contribute to their core product features. The role involves backend development, gRPC clients and servers, and continuous learning. The company offers a competitive compensation package, flexible paid time off, and a commitment to building a culture of mentorship, equity, and psychological safety. They are looking for individuals who are passionate about open source, security, and building an enjoyable UX.
Senior Backend Engineer - Styles
Company: Webflow
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> At Webflow our mission is to bring development superpowers to everyone Webflow is the leading visual development platform for building powerful websites without writing code By combining modern web development technologies into one platform Webflow enables people to build websites visually saving engineering time while clean code seamlessly generates in the background From independent designers and creative agencies to Fortune 500 companies millions worldwide use Webflow to be more nimble creative and collaborative Its the web made better <p> <p> The Styles team is responsible for building and investing in the design capabilities of our core product to empower millions of designers worldwide to easily adopt Webflow to build manage and scale any number of sites efficiently <p> <p> Were looking for a Senior Backend Engineer to join the Styles team and lead the team to deliver impactful features for our customers to build highly personalized web experiences In this role you will execute the technical direction and be a mentor amp partner to other engineers on the team Additionally you will help lead crossfunctional efforts to drive even greater impact <p> <h2> <strong> About the role <strong> <h2> <ul> <li> <p> Location Remotefirst United States BC amp ON Canada <p> <li> <li> <p> Fulltime <p> <li> <li> <p> Permanent <p> <li> <li> <p> Exempt US Candidates <p> <li> <li> <p> Reporting to the Engineering Manager of Designer UX team <p> <li> <li> <p> The cash compensation for this role is tailored to align with the cost of labor in different geographic markets Weve structured the base pay ranges for this role into zones for our geographic markets and the specific base pay within the range will be determined by the candidates geographic location jobrelated experience knowledge qualifications and skills <p> <ul> <li> <p> Zone A $162500 $216050 <p> <li> <li> <p> Zone B $152700 $203100 <p> <li> <li> <p> Zone C $143000 $190150 <p> <li> <ul> <ul> <li> <p> CAD 184600 CAD 245500 <p> <li> <ul> <ul> <li> <p> United States all figures cited below in USD and pertain to workers in the United States <p> <li> <li> <p> Canada All figures cited below in CAD and pertain to workers in ON amp BC Canada <p> <li> <ul> <li> <ul> <p> Please visit our <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowaboutwebflowiocareers rel=noopener noreferrer nofollow target=blank> Careers page <a> for more information on which locations are included in each of our geographic pay zones However please confirm the zone for your specific location with your recruiter <p> <p> As a Senior Backend Engineer youll <p> <ul> <li> <p> Design and implement scalable backend services <p> <li> <li> <p> Drive crosspillar collaboration with software engineers product managers designers and QA analysts in an autonomous supportive team environment <p> <li> <li> <p> Effectively communicate team priorities and strategy to engineering and crossfunctional leadership teams <p> <li> <li> <p> Build and maintain unit and integration tests <p> <li> <li> <p> Provide clarity on processes and priorities to crosspillar partners and other engineers on the team <p> <li> <li> <p> Mentor other engineers on best practices code design considerations and quality <p> <li> <ul> <p> In addition to the responsibilities outlined above at Webflow we will support you in identifying where your interests and development opportunities lie and well help you incorporate them into your role <p> <h2> <strong> About you <strong> <h2> <p> Youll thrive as a Senior Backend Engineer Styles if you <p> <ul> <li> <p> Have 5+ years of experience in scalable multitenant environments <p> <li> <li> <p> Have 2+ years experience working with feature teams on customerfacing products shipping and iterating to solve customer problems <p> <li> <li> <p> Value testing and documentation equally as much as your code <p> <li> <li> <p> Are comfortable with ambiguity and scoping solutions with your teammates <p> <li> <li> <p> Are comfortable working on JavascriptTypescript MongoDB and Node <p> <li> <li> <p> Have consistently communicated trade offs throughout a project to meet both technical and business requirements <p> <li> <li> <p> Enjoy highvisibility work and presenting to executive counterparts <p> <li> <li> <p> Get excited about encouraging and developing other engineers <p> <li> <ul> <p> Even if you dont meet 100 of the above qualifications you should still seriously consider applying Research shows that you may still be considered for a role if you meet just half of the requirements <p> <p> <strong> Our Core Behaviors <strong> <p> <ul> <li> <p> <strong> Obsess over customer experience <strong> We deeply understand what were building and who were building for and serving We define the leading edge of whats possible in our industry and deliver the future for our customers <p> <li> <li> <p> <strong> Move with heartfelt urgency <strong> We have a healthy relationship with impatience channeling it thoughtfully to show up better and faster for our customers and for each other Time is the most limited thing we have and we make the most of every moment <p> <li> <li> <p> <strong> Say the hard thing with care <strong> Our best work often comes from intelligent debate critique and even difficult conversations We speak our minds and dont sugarcoat things and we do so with respect maturity and care <p> <li> <li> <p> <strong> Make your mark <strong> We seek out new and unique ways to create meaningful impact and we champion the same from our colleagues We work as a team to get the job done and we go out of our way to celebrate and reward those going above and beyond for our customers and our teammates <p> <li> <ul> <h3> <strong> Benefits amp wellness <strong> <h3> <ul> <li> <p> Equity ownership RSUs in a growing privatelyowned company <p> <li> <li> <p> 100 employerpaid healthcare vision and dental insurance coverage for employees and dependents fulltime employees working 30+ hours per week as well as Health Savings AccountHealth Reimbursement Account dependent care Flexible Spending Account US only dependent on insurance plan selection where applicable in the respective country of employment Employees may also have voluntary insurance options such as life disability hospital protection accident and critical illness where applicable in the respective country of employment <p> <li> <li> <p> 12 weeks of paid parental leave for both birthing and nonbirthing caregivers as well as an additional 68 weeks of pregnancy disability for birthing parents to be used before child bonding leave where local requirements are more generous employees receive the greater benefit Employees also have access to family planning care and reimbursement <p> <li> <li> <p> Flexible PTO with a mandatory annual minimum of 10 days paid time off for all locations where local requirements are more generous employees receive the greater benefit and sabbatical program <p> <li> <li> <p> Access to mental wellness and professional coaching therapy and Employee Assistance Program <p> <li> <li> <p> Monthly stipends to support health and wellness smart work and professional growth <p> <li> <li> <p> Professional career coaching internal learning amp development programs <p> <li> <li> <p> 401k plan and pension schemes in countries where statutorily required financial wellness benefits like CPA or financial advisor coverage <p> <li> <li> <p> Discounted Pet Insurance offering US only <p> <li> <li> <p> Commuter benefits for inoffice employees <p> <li> <ul> <p> <em> Temporary employees are not eligible for paid holiday time off accrued paid time off paid leaves of absence or companysponsored perks unless otherwise required by law <em> <p> <h3> <strong> Be you with us <strong> <h3> <p> At Webflow equality is a core tenet of our culture We are an Equal Opportunity EEOVeteransDisabled Employer and are <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomdiversityequityinclusion rel=noopener noreferrer nofollow target=blank> committed <a> to building an inclusive global team that represents a variety of backgrounds perspectives beliefs and experiences Employment decisions are made on the basis of jobrelated criteria without regard to race color religion sex sexual orientation gender identity national origin disability veteran status or any other classification protected by applicable law Pursuant to the San Francisco Fair Chance Ordinance Webflow will consider for employment qualified applicants with arrest and conviction records <p> <h3> <strong> Stay connected <strong> <h3> <p> Not ready to apply but want to be part of the Webflow community Consider following our story on our <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomblog rel=noopener noreferrer nofollow target=blank> Webflow Blog <a> <a class=fontbold underline fontbold underline fontbold underline href=httpswwwlinkedincomcompanywebflowinc rel=noopener noreferrer nofollow target=blank> LinkedIn <a> <a class=fontbold underline fontbold underline fontbold underline href=httpstwittercomwebflow rel=noopener noreferrer nofollow target=blank> X Twitter <a> andor <a class=fontbold underline fontbold underline fontbold underline href=httpswwwglassdoorcomReviewsWebflowReviewsE890506htm rel=noopener noreferrer nofollow target=blank> Glassdoor <a> <p> <h3> <strong> Please note <strong> <h3> <p> <em> We will ensure that individuals with disabilities are provided reasonable accommodation to participate in the job application or interview process to perform essential job functions and to receive other benefits and privileges of employment Upon interview scheduling instructions for confidential accommodation requests will be administered <em> <p> <p> <em> To join Webflow youll need a valid right to work authorization depending on the country of employment <em> <p> <p> <em> If you are extended an offer that offer may be contingent upon your successful completion of a background check which will be conducted in accordance with applicable laws We may obtain one or more background screening reports about you solely for employment purposes <em> <p> <p> <em> For information about how Webflow processes your personal information please review <em> <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomlegalapplicantprivacynotice rel=noopener noreferrer nofollow target=blank> <em> Webflows Applicant Privacy Notice <em> <a> <em> <em> <p><p>
Account Executive (Manager/Director of Strategic Accounts)
Company: OfferFit
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> <strong> Position Overview <strong> <p> <p> Were currently looking for a driven Account Executive ManagerDirector of Strategic Accounts to join our team In this role youll be responsible for winning and growing business for OfferFit by owning new and existing senior customer relationships <p> <p> <strong> In particular you will <strong> <p> <ul> <li> <p> Working closely with our business development amp marketing teams to create leads <p> <li> <li> <p> Lead discussions with potential new OfferFit customers <p> <li> <li> <p> Work with current and future OfferFit customers to determine the highestimpact applications of our AIsolution <p> <li> <li> <p> Participate in OfferFit POV motion to ensure they progress successfully working closely with OfferFits technical Implementation team <p> <li> <li> <p> Build amp own relationships with senior leaders at OfferFits customer companies eg CMOs CIOs <p> <li> <li> <p> Communicate customer needs to OfferFits product amp marketing teams ensuring a customercentric product roadmap <p> <li> <ul> <p> <strong> Why is it great <strong> <p> <ul> <li> <p> Be the face of the company working alongside our customers to help them succeed <p> <li> <li> <p> Sell a product with strong productmarket fit the pain of manual experimentation is a real pain point for marketers leading to a high level of enthusiasm for our products <p> <li> <li> <p> Get strong support from leadership OfferFit prioritizes sales helping your team succeed will be a true priority for the CEO and other Sales leadership team members <p> <li> <li> <p> Lead the AI transformation happening in marketing technology today OfferFit is at the forefront so youll be in the middle of the action <p> <li> <li> <p> Join OfferFits fastpaced supportive and professional team We make sure all of our team members are empowered and receive great mentorship and coaching <p> <li> <ul> <p> <strong> Whos a fit <strong> <p> <ul> <li> <p> Executionfocused leader you can structure a plan align stakeholders and see it through to execution <p> <li> <li> <p> People person you build trustbased relationships with internal team members and external partners and combine empathy with a willingness to have direct challenging conversations <p> <li> <li> <p> Processdriven you can create scalable frameworks to optimize the success of business outcomes <p> <li> <li> <p> Entrepreneurial you take initiative work around obstacles and always seek creative ways to get to the next level <p> <li> <li> <p> Technology enthusiast you are passionate about new technologies and their potential to impact businessasusual <p> <li> <li> <p> Clear communicator you are able to express yourself clearly and persuasively both in writing and speech <p> <li> <li> <p> Sales expert you have a history of enterprise sales and are wellversed in SPIN selling amp MEDDPICC qualification methodology <p> <li> <ul> <p> The base salary range for this position in the United States is $81000$142000 per year plus eligibility for additional commissionbonus ranging $91000$162000 with an overall OTE of $172000$305000 ability to earn more based on sales goals Eligibility for an additional end of year performance bonus commissions when applicable andor equity options may be provided as part of the compensation package in addition to a full range of medical financial andor other benefits depending on the position offered For nonUS based candidates base pay and overall compensation packages will be adjusted based on location Applicants should apply via OfferFits internal or external careers site <p> <p> <strong> OfferFit Benefits and Perks <strong> <p> <ul> <li> <p> Generous PTO starting at 25 days PTO per year and Parental leave policy 12 weeks paid <p> <li> <li> <p> 100 remote work environment with flexible hours <p> <li> <li> <p> Quarterly gatherings where we meet in person in a different city to work together bond as a team and celebrate our progress <p> <li> <li> <p> Weekly team events lunch and learns trivia virtual escape rooms town hall and team health barometer meetings <p> <li> <li> <p> Ability to learn and develop from an experienced leadership team exAmazon McKinsey BCG and IBM among others who are focused on building a talented diverse and inclusive tea <p> <li> <li> <p> Dedication to building a strong culture eg team resource groups weekly recognitions major life event celebrations mental healthsustainability days off etc <p> <li> <li> <p> US Only Competitive benefits major medical vision dental and LTD and 401K matching program <p> <li> <ul><p>
Staff Software Engineer - Foundation
Company: Apollo
Location: USA
Posted Apr 29, 2024
<p class=jobDescription> <p> Are you a talented and driven distributed systems engineer with a proven track record capable of leading crossorganizational features Does tech debt quiver in its boots at the sound of your name Do you butter your bread with evented systems Have the letters C Q R and S been ruined for you in an eventually consistent manner Have we got news for you youre not alone <p> <p> <p> <p> In this highimpact role youll be a leader on our Platform Engineering team Youll help foster our best Platform Engineers think SRE meets Ops with a heavy focus on automation of everything setting a consistent example for how we lead projects and how we maintain our documents dashboards and code bases Our teams current focus is on Service Delivery Kubernetes Infrastructure Management Terraform CICD Argo Atlantis and in general all things SLOs and Operational Excellence Your teammates are talented folks who value code that is 80 of the value for 20 of the work designs that are forwardthinking enough to be easily flexible for the next features and leadership with a healthy dose of mindfulness and humility <p> <p> <p> <p> Apollo is the worldwide leader of GraphQL innovation Companies like Netflix Walmart Expedia Peloton DoorDash The New York Times and Zillow are just a small sample of Apollos customers Our opensource product has millions of downloads every week According to the new Gartner report by 2027 more than 60 of enterprises will use GraphQL in production up from less than 30 in 2024 and 30 of those enterprises will be using GraphQL federation which Apollo pioneered <p> <p> <p> <p> GraphQL is transforming the software development space by creating a brand new layer in companies stacks called the supergraph that helps engineering teams ship faster and build richer experiences than ever before Join us and build the future of Apollos internal Developer Platform <p> <p> <p> <p> <p> <p> <strong> What Youll Do <strong> <p> <ul> <li> <p> Youll become a key Domain owner for the team taking responsibility for our cloud infrastructure in partnership with our Platform Security team and especially for our Service Delivery Platform namely K8s <p> <li> <li> <p> You will lead crossteam groups of developers and shepherd largeimpact initiatives along either as the technical leader or coaching members of the team to become technical leaders <p> <li> <li> <p> Youll mentor junior members of the team and help with interviewing potential teammates <p> <li> <li> <p> Youll create technical designs that proactively address cost efficiency security and observability <p> <li> <li> <p> Youll deliver technical plans onepagers DRs and other artifacts <p> <li> <li> <p> Youll work with Kubernetes GCP Helm Terraform DataDog ArgoCD CircleCI Atlantis Docker the list goes on to deliver your work <p> <li> <li> <p> Youll be responsible for improving developer velocity across the company leveraging frameworks like DORA and hardening our reliability and observability <p> <li> <li> <p> Youll participate in oncall rotation <p> <li> <ul> <p> <p> <p> <strong> About You <strong> <p> <ul> <li> <p> You have proven systems expertise and experience with statelessfault tolerant systems as well as working familiarity with eventing patterns and distributed paradigms <p> <li> <li> <p> You are adept at weighing technical and business tradeoffs and are exceptional at seeing down the road and around corners <p> <li> <li> <p> You enjoy crossteam collaboration and believe in a rising tides lifts all boats mentality Youre a joy to those around you bringing everyone along for the ride <p> <li> <li> <p> You are dataoriented and leverage data to make decisions in a concrete way <p> <li> <li> <p> You are an expert with Kubernetes GCP preferably but AWS or Azure is great too and Terraform <p> <li> <li> <p> Bonus points for Helm Docker ArgoCD CircleCI DataDog and of course GraphQL <p> <li> <ul> <p> <p> <p> <p> <p> $167000 $212000 a year <p> <p> At Apollo we strive to provide competitive marketinformed compensation whilst ensuring consistency within the team in each country We make hiring decisions based on your skills experience and our overall assessment of what we learned during the hiring process <p> <p> <p> <p> In addition to the US base salary range we also provide equity and benefits Apollo offers all US employees a choice of 3 Anthem Blue Cross medical plans and California residents can also choose from an additional 2 Kaiser medical plans Dental and Vision benefits are provided by Sun Life Financial <p> <p> <p> <p> Location This is a remote position that can be done from anywhere in the United States or Canada <p> <p> <p> <p> Equal Opportunity Apollo is proud to be an equal opportunity workplace dedicated to pursuing and hiring a talented and diverse workforce <p> <p> <p> <p> Privacy California residents applying for positions at Apollo can see our privacy policy <a class=fontbold underline fontbold underline postingslink href=httpswwwapollographqlcomCCPAPrivacyNoticeforEmployeespdf rel=noopener noreferrer nofollow target=blank> here <a> <p> <p> <p> <p> EVerify Apollo is an EVerify employer and will provide the federal government with your Form I9 information to confirm that you are authorized to work in the US For more information please visit <a class=fontbold underline fontbold underline postingslink href=httpswwweverifygov rel=noopener noreferrer nofollow target=blank> EVerify <a> <p><p>