Loan Assistance Jobs in USA
215,980 open positions · Updated daily
Looking for Loan Assistance jobs in USA? Browse our curated listings with transparent salary information to find the perfect Loan Assistance position in the USA area.
Senior Backend Engineer - Shared Services
Company: Webflow
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> At Webflow our mission is to bring development superpowers to everyone Webflow is the leading visual development platform for building powerful websites without writing code By combining modern web development technologies into one platform Webflow enables people to build websites visually saving engineering time while clean code seamlessly generates in the background From independent designers and creative agencies to Fortune 500 companies millions worldwide use Webflow to be more nimble creative and collaborative Its the web made better <p> <p> We are looking for a Senior Backend Engineer to join the Shared Services team to enable our engineering team to build more efficiently so we can further our mission of bringing visual development superpowers to everyone If youre passionate about engineering excellence and driving operational efficiency wed love to hear from you <p> <h2> <strong> About the role <strong> <h2> <ul> <li> <p> Location Remotefirst United States BC amp ON Canada <p> <li> <li> <p> Fulltime <p> <li> <li> <p> Permanent <p> <li> <li> <p> Exempt <p> <li> <li> <p> The cash compensation for this role is tailored to align with the cost of labor in different geographic markets Weve structured the base pay ranges for this role into zones for our geographic markets and the specific base pay within the range will be determined by the candidates geographic location jobrelated experience knowledge qualifications and skills <p> <ul> <li> <p> United States all figures cited below in USD and pertain to workers in the United States <p> <ul> <li> <p> Zone A $162500 $216050 <p> <li> <li> <p> Zone B $152700 $203100 <p> <li> <li> <p> Zone C $14300 $190150 <p> <li> <ul> <li> <li> <p> Canada All figures cited below in CAD and pertain to workers in ON amp BC Canada <p> <ul> <li> <p> CAD 184600 CAD 245500 <p> <li> <ul> <li> <ul> <li> <li> <p> Please visit our <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowaboutwebflowiocareers rel=noopener noreferrer nofollow target=blank> Careers page <a> for more information on which locations are included in each of our geographic pay zones However please confirm the zone for your specific location with your recruiter <p> <li> <li> <p> Reporting to the engineering manager <p> <li> <ul> <p> As Senior Backend Engineer youll <p> <ul> <li> <p> Develop a comprehensive knowledge of how areas of business such as architecture and infrastructure integrate to improve developer productivity and accomplish our business goals <p> <li> <li> <p> Collaborate with software engineers product managers designers and QA analysts in an autonomous supportive team environment <p> <li> <li> <p> Build and maintain shared services including but not limited to Inapp Email Notification platform and Feature Flag framework <p> <li> <li> <p> Identify develop and document APIs for Webflows service catalog as well as provide quick start guides for developer best practices <p> <li> <li> <p> Solve problems in a highly technical platform that empowers hundreds of engineers <p> <li> <li> <p> Improve our planning development and deployment processes to help you and your fellow team members <p> <li> <li> <p> Mentor coach and inspire a team of engineers of various levels <p> <li> <ul> <p> In addition to the responsibilities outlined above at Webflow we will support you in identifying where your interests and development opportunities lie and well help you incorporate them into your role <p> <h2> <strong> About you <strong> <h2> <p> Youll thrive in this role if you <p> <ul> <li> <p> Have 5+ years developing and deploying web applications with a proven track record of shipping to market <p> <li> <li> <p> Excellent organization and communication skills both verbal and written <p> <li> <li> <p> Have worked on complex issues where the analysis requires an indepth knowledge of the company and existing architecture <p> <li> <li> <p> Can debug production issues across services and multiple levels of the stack <p> <li> <li> <p> Take pride in taking ownership and driving projects to business impact <p> <li> <li> <p> Proven experience building complex web systems <p> <li> <li> <p> Are familiar with one or more Javascript type systems we use TypeScript here <p> <li> <li> <p> Are comfortable working in an agile safetofail environment <p> <li> <ul> <p> <strong> Our Core Behaviors <strong> <p> <ul> <li> <p> <strong> Obsess over customer experience <strong> We deeply understand <em> what <em> were building and <em> who <em> were building for and serving We define the leading edge of whats possible in our industry and deliver the future for our customers <p> <li> <li> <p> <strong> Move with heartfelt urgency <strong> We have a healthy relationship with impatience channeling it thoughtfully to show up better and faster for our customers and for each other Time is the most limited thing we have and we make the most of every moment <p> <li> <li> <p> <strong> Say the hard thing with care <strong> Our best work often comes from intelligent debate critique and even difficult conversations We speak our minds and dont sugarcoat things and we do so with respect maturity and care <p> <li> <li> <p> <strong> Make your mark <strong> We seek out new and unique ways to create meaningful impact and we champion the same from our colleagues We work as a <em> team <em> to get the job done and we go out of our way to celebrate and reward those going above and beyond for our customers and our teammates <p> <li> <ul> <h3> <strong> Benefits amp wellness <strong> <h3> <ul> <li> <p> Equity ownership RSUs in a growing privatelyowned company <p> <li> <li> <p> 100 employerpaid healthcare vision and dental insurance coverage for employees and dependents fulltime employees working 30+ hours per week as well as Health Savings AccountHealth Reimbursement Account dependent care Flexible Spending Account US only dependent on insurance plan selection where applicable in the respective country of employment Employees may also have voluntary insurance options such as life disability hospital protection accident and critical illness where applicable in the respective country of employment <p> <li> <li> <p> 12 weeks of paid parental leave for both birthing and nonbirthing caregivers as well as an additional 68 weeks of pregnancy disability for birthing parents to be used before child bonding leave where local requirements are more generous employees receive the greater benefit Employees also have access to family planning care and reimbursement <p> <li> <li> <p> Flexible PTO with a mandatory annual minimum of 10 days paid time off for all locations where local requirements are more generous employees receive the greater benefit and sabbatical program <p> <li> <li> <p> Access to mental wellness and professional coaching therapy and Employee Assistance Program <p> <li> <li> <p> Monthly stipends to support health and wellness smart work and professional growth <p> <li> <li> <p> Professional career coaching internal learning amp development programs <p> <li> <li> <p> 401k plan and pension schemes in countries where statutorily required financial wellness benefits like CPA or financial advisor coverage <p> <li> <li> <p> Discounted Pet Insurance offering US only <p> <li> <li> <p> Commuter benefits for inoffice employees <p> <li> <ul> <h3> <strong> Be you with us <strong> <h3> <p> At Webflow equality is a core tenet of our culture We are an Equal Opportunity EEOVeteransDisabled Employer and are <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomdiversityequityinclusion rel=noopener noreferrer nofollow target=blank> committed <a> to building an inclusive global team that represents a variety of backgrounds perspectives beliefs and experiences Employment decisions are made on the basis of jobrelated criteria without regard to race color religion sex sexual orientation gender identity national origin disability veteran status or any other classification protected by applicable law Pursuant to the San Francisco Fair Chance Ordinance Webflow will consider for employment qualified applicants with arrest and conviction records <p> <h3> <strong> Stay connected <strong> <h3> <p> Not ready to apply but want to be part of the Webflow community Consider following our story on our <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomblog rel=noopener noreferrer nofollow target=blank> Webflow Blog <a> <a class=fontbold underline fontbold underline fontbold underline href=httpswwwlinkedincomcompanywebflowinc rel=noopener noreferrer nofollow target=blank> LinkedIn <a> <a class=fontbold underline fontbold underline fontbold underline href=httpstwittercomwebflow rel=noopener noreferrer nofollow target=blank> X Twitter <a> andor <a class=fontbold underline fontbold underline fontbold underline href=httpswwwglassdoorcomReviewsWebflowReviewsE890506htm rel=noopener noreferrer nofollow target=blank> Glassdoor <a> <p> <h3> <strong> Please note <strong> <h3> <p> <em> To join Webflow youll need valid US or Canadian work authorization depending on the country of employment <em> <p> <p> <em> If you are extended an offer that offer may be contingent upon your successful completion of a background check which will be conducted in accordance with applicable laws We may obtain one or more background screening reports about you solely for employment purposes <em> <p> <p> <em> For information about how Webflow processes your personal information please review <em> <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomlegalapplicantprivacynotice rel=noopener noreferrer nofollow target=blank> <em> Webflows Applicant Privacy Notice <em> <a> <em> <em> <p> <p> <p><p>
Director - Corporate FP&A
Company: Icertis
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> With unmatched technology and categorydefining innovation Icertis pushes the boundaries of whats possible with contract lifecycle management CLM The AIpowered analystvalidated Icertis Contract Intelligence ICI platform turns contracts from static documents into strategic advantage by structuring and connecting the critical contract information that defines how an organization runs Today the worlds most iconic brands and disruptive innovators trust Icertis to fully realize the intent of their combined 10 million contracts worth more than $1 trillion in 40+ languages and 93 countries <p> <p> <p> <p> <strong> Who we are <strong> Icertis is the only contract intelligence platform companies trust to keep them out in front now and in the future Our unwavering commitment to contract intelligence is grounded in our FORTE valuesFairness Openness Respect Teamwork and Executionwhich guide all our interactions with employees customers partners and stakeholders Because in our mission to be the contract intelligence platform of the world we believe how we get there is as important as the destination <p> <p> <p> <p> As the Director of FPampA you will play a critical leadership role you will work closely with all of companys functional leaders and bring key market strategic and operational insights that will shape the direction of the company and accelerate its growth You will also play a key role in telling the companys financial story to investors <p> <p> <p> <p> The ideal candidate will have a proven trackrecord of driving business outcomes through keen financial insight and business modeling They will have the ability to create a 360degree financial picture of the business that reflects and influences the companys strategy and be excellent at communicating with senior leaders and executives They will be toolsavvy with experience in creating scalable data and reporting solutions that support a datadriven culture LIRS1 <p> <p> <p> <p> <p> <p> <strong> What you will do <strong> <p> <ul> <li> <p> Formulate a robust 360degree financial picture of the business complete with market insights and operational drivers <p> <li> <li> <p> Develop and maintain the 3year Strategic Planning Model and forecast <p> <li> <li> <p> Deliver Global PampL and cash flow forecasts <p> <li> <li> <p> Drive Annual Planning Process work cross functionally to build and maintain the Annual Financial Plan and Departmental Budgets <p> <li> <li> <p> Build and deliver Business Performance ReportingOperating dashboards <p> <li> <li> <p> Perform strategic business analysis as needed MampA Geo Expansion <p> <li> <li> <p> Prepare financial analyses as needed to help drive improvements in the business Current focus areas include market expansion opportunities competitive benchmarking analyses pricing and strategic financial optimization strategies <p> <li> <li> <p> Partner with Controller to enhance and accelerate the financial reporting process <p> <li> <li> <p> Identifies and implements system and process improvements to increase the efficiency and effectiveness of planning and reporting workflows <p> <li> <li> <p> Prepare communications to Board of Directors <p> <li> <li> <p> Drive investor presentations and supporting analysis <p> <li> <li> <p> Develop a deep understanding of the business metrics with an eye towards understanding the benefits and risks from a financial perspective and helping to manage key business drivers and desired outcomes <p> <li> <li> <p> Play a key role in preparation of critical public financial documents to support the IPO process including working with bankers and supporting the production of investor materials and SEC filings eg S1 <p> <li> <ul> <p> <p> <p> <strong> What you will bring <strong> <p> <ul> <li> <p> 12+ years of experience of working in direct strategic analysis support of all aspects of the business at all areas of the PampL <p> <li> <li> <p> MBACPA or equivalent experience preferred <p> <li> <li> <p> Demonstrated complex modeling experience this is a handson role and managers are expected to directly contribute and lead by example <p> <li> <li> <p> Highly analytical detailoriented with a commitment to creating a highquality product Naturally inquisitive and able to extract information from various sources to identify and understand the underlying issue Not afraid to question results <p> <li> <li> <p> Prior success working in a fastpaced entrepreneurial environment takes initiative and works independently <p> <li> <li> <p> Working knowledge of accounting principles required including revenue recognition amortization and accrual vs cash accounting Must have a general understanding of financial statements <p> <li> <li> <p> Must have exceptional written visual and spoken communication skills <p> <li> <li> <p> Experience in preparing and delivering executive board and investor level communications <p> <li> <li> <p> IPO experience is a plus <p> <li> <li> <p> Must have advanced Excel Netsuite and Powerpoint skills <p> <li> <li> <p> Experience implementing financial analysis and planning tools required <p> <li> <ul> <p> <p> <p> <p> <p> $146000 $219000 a year <p> <p> <em> Pay offered will vary based on jobrelated factors such as location experience training skills and abilities In addition to the base salary and annual bonus target and an equity component is included in the compensation package <em> <p> <p> <strong> What we offer <strong> <p> <p> We are committed to the health and wellbeing of all Icertians their families the communities they live in and our customers This commitment is represented in the Icertis Four Rings of Responsibility Take Care of Self Take Care of Family Take Care of Community and Take Care of Business in that order <p> <p> <p> <p> To support these commitments Icertis offers excellent health and welfare benefits a generous 401k match and a robust paid time off program Here are some of the other reasons <a class=fontbold underline fontbold underline postingslink href=httpswwwicertiscomcompanynewsicertisplacesfirstinwashingtons100bestcompaniestoworkfor rel=noopener noreferrer nofollow target=blank> Icertis Places First in Washingtons 100 Best Companies to Work For | Icertis <a> <p> <p> <p> <p> ● Equity RSUs and shared ownership in the company <p> <p> ● Flexible work environment <p> <p> ● Paid maternity and paternity leave <p> <p> ● 7 Days for Humanity 7 paid volunteer days <p> <p> ● Generous holidays including the 4th of July week off paid <p> <p> ● Free professional and leadership coaching <p> <p> ● Annual personal development allowance <p> <p> <p> <p> Icertis Inc provides Equal Employment Opportunity to all employees and applicants for employment without regard to race color religion gender identity or expression sex sexual orientation national origin age disability genetic information marital status amnesty or status as a covered veteran in accordance with applicable federal state and local laws Icertis Inc complies with applicable state and local laws governing nondiscrimination in employment in every location in which the company has facilities If you are in need of accommodation or special assistance to navigate our website or to complete your application please send an email with your request to <a class=fontbold underline fontbold underline postingslink href=mailtocareersicertiscom rel=noopener noreferrer nofollow target=blank> careersicertiscom <a> or get in touch with your recruiter <p> <p> <p> <p> By submitting your application you acknowledge that you have read Icertiss Privacy Policy <a class=fontbold underline fontbold underline postingslink href=httpswwwicertiscomprivacystatement rel=noopener noreferrer nofollow target=blank> httpswwwicertiscomprivacystatement <a> <p> <p> <p> <p> Icertis is not open to third party solicitation or resumes for our posted FTE positions Resumes received from third party agencies that are unsolicited will be considered complimentary <p><p>
Brand Designer
Company: Modern Health
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <h2> The Role <h2> <p> Are you an ambitious creative professional Does joining a rapidlygrowing tech company in the health and mental wellbeing space sound exciting The Marketing team at Modern Health is hiring a Brand Designer to help build our brand identity as we expand executing a wide range of projects including web content email newsletters videos advertising conference materials sales presentations onesheeters and much more You will be a key member of the Marketing team collaborating across product customer success clinical care and recruiting to build a cohesive elevated brand for Modern Health and to ensure specific messages are being visually conveyed through your designs <p> <p> This position is not eligible to be performed in Hawaii <p> <h2> <strong> What Youll Do <strong> <h2> <ul> <li> <p> Manage project request intake and scope clarification <p> <li> <li> <p> Design and development of marketing materials including website pages presentations print and digital advertising conference materials research reports social media campaigns onesheeters postcards promotions videos webinars and other marketing collateral <p> <li> <li> <p> Collaborate with other marketing and product team members to ensure quality and consistency in all aspects of our brand presence <p> <li> <li> <p> Provide status updates and juggle multiple projectswere an agile team with shifting priorities <p> <li> <li> <p> Become an informed and vocal advocate of great design at Modern Health <p> <li> <ul> <h2> <strong> Who You Are <strong> <h2> <ul> <li> <p> 3+ years of design experience in a fastpaced highgrowth environment <p> <li> <li> <p> MUST have an online portfolio of relevant work examples <p> <li> <li> <p> Handson experience with Figma Adobe Creative Suite including Photoshop and llustrator <p> <li> <li> <p> Use of MS Office and Google Docs and how those are used crossfunctionally with Adobe CS <p> <li> <li> <p> Experience working with web developer to develop website pages <p> <li> <li> <p> Knowledge of how to prepare files for optimal online use and print bleed areas CMYK Pantone RGB etc <p> <li> <li> <p> Understand the different pixel resolutions required for print and online <p> <li> <li> <p> Experience working within existing brand guidelines andor designing new brand guidelines <p> <li> <li> <p> Must be highly detail oriented and selfmotivated and able to prioritize your workload to meet critical deadlines <p> <li> <li> <p> Able to work well independently as well as under the direction of others <p> <li> <li> <p> Coachable and values constructive criticism from a variety of sources <p> <li> <li> <p> Excellent written and verbal communication skills <p> <li> <li> <p> Curious creative flexible proactive and ambitious <p> <li> <ul> <h2> <strong> Benefits <strong> <h2> <p> Fundamentals <p> <ul> <li> <p> Medical Dental Vision Disability Life Insurance <p> <li> <li> <p> High Deductible Health Plan with Health Savings Account HSA option <p> <li> <li> <p> Flexible Spending Account FSA <p> <li> <li> <p> Access to coaches and therapists through Modern Healths platform <p> <li> <li> <p> Generous Time Off <p> <li> <li> <p> Companywide Collective Pause Days <p> <li> <ul> <p> Family Support <p> <ul> <li> <p> Parental Leave Policy <p> <li> <li> <p> Family Forming Benefit through Carrot <p> <li> <li> <p> Family Assistance Benefit through UrbanSitter <p> <li> <ul> <p> Professional Development <p> <ul> <li> <p> Professional Development Stipend <p> <li> <ul> <p> Financial Wellness <p> <ul> <li> <p> 401k <p> <li> <li> <p> Financial Planning Benefit through Origin <p> <li> <ul> <p> But wait theres more <p> <ul> <li> <p> Annual Wellness Stipend to use on items that promote your overall well being <p> <li> <li> <p> New Hire Stipend to help cover workfromhome setup costs <p> <li> <li> <p> ModSquad Community Virtual events like active ERGs holiday themed activities teambuilding events and more <p> <li> <li> <p> Monthly Cell Phone Reimbursement <p> <li> <ul><p>
Customer Support Representative
Company: VETRO FiberMap
Location: USA
Posted Apr 29, 2024
VETRO FiberMap, a high-growth SaaS company based in Portland, Maine, is seeking a Customer Support Representative. The role involves supporting smooth adoption of a mapping software platform used by broadband providers. The ideal candidate should be passionate about helping customers and colleagues, enjoy solving complex data and technical problems, and have a minimum of 2-3 years of relevant work experience. The position offers full benefits, a starting salary of $60,000, and is a remote-first opportunity.
Accounting Manager
Company: Underdog Fantasy
Location: USA
Posted Apr 30, 2024
Underdog is a fast-growing sports gaming company that is building innovative games and products for American sports fans. They are looking for a financial operations manager to join their team.
Vice President of Product Management
Company: Workiva
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> <strong> Job Summary <strong> Workiva is looking for an exceptional product leader to take over a highperforming team and expand our global ambitions in the rapidly growing multibillion dollar technology market for Sustainability and ESG solutions Already one of the most successful Sustainability and ESG reporting technology providers with hundreds of toptier clients this role will have an opportunity to expand the capabilities Workiva offers to address the data process and regulatory challenges faced by our customers and partners Workiva is transforming the way finance sustainability risk and audit teams work together and this role will play a pivotal leadership role in driving growth and delighting customers Experience leading teams in a fastpaced highgrowth market and operating in an agile development environment is important <p> <p> The <strong> VP of Product Management for Sustainability and Environmental Social and Governance ESG <strong> at Workiva defines the global product strategy for Workivas Sustainability and ESG solution area and influences business strategy through organizational leadership and people management The VP defines the product vision and strategy across Sustainability and ESG Solution domain areas but also collaborates across Workivas solutions in finance risk and audit to ensure Workivas global leadership in the market as well as championing our customers success This role offers the right candidate the opportunity to be at the forefront of helping companies drive lasting positive business environmental and stakeholder change across industries <p> <p> <strong> What Youll Do <strong> <strong> Product Management Leadership and Stakeholder Relationship Management <strong> <em> Drives the work of the Sustainability and ESG Product Management team identifying ESG and Sustainability macrotrends affecting the customer business processes and data requirements and defining related software product requirements with a focus on the needs of the global ESG and Sustainability teams and professionals Leads the decisionmaking through ambiguity to deliver worldclass products through the ability to make decisions with imperfect data building hypotheses and validating them with a datacentric approach <em> <p> <ul> <li> <p> <strong> Strategic Vision <strong> Ability to envision strategic pathways and seize growth opportunities in a competitive market setting Encourages growth innovation and collaboration so that product managers and their teams are operating at a high level of performance Specifically will ensure the Sustainability and ESG solutions and platform capabilities are aligned with the broader Workiva Platform vision <p> <li> <li> <p> <strong> UserCentric Approach <strong> Ensure deep comprehension of user needs behaviors and pain points with a commitment to delivering customer value while driving commercial outcomes <p> <li> <li> <p> <strong> DataDriven Decision Making <strong> Proficient in utilizing data analytics user feedback and market research to inform product decisions prioritize initiatives and set timelines <p> <li> <li> <p> <strong> Customer and Partner Engagement <strong> Proven ability to engage effectively with customers partners and internal customer and partner success teams gathering feedback validating hypotheses and ensuring alignment with product strategy and goals <p> <li> <li> <p> <strong> Proactive Leadership <strong> Track record of effectively driving strategic purpose focus and priorities forward within a complex organizational structure actively defining features requirements timelines and prioritization <p> <li> <li> <p> <strong> Product Expertise <strong> In collaboration with Workivas wider Sustainability and ESG subject matter expert community you will function as the Product Management subject matter expert for ESG and Sustainability to share solution best practices across the company <p> <li> <li> <p> <strong> Effective Communication <strong> Exceptional verbal and written communication skills adept at engaging and influencing senior leadership at various levels <p> <li> <li> <p> <strong> Agile Methodologies <strong> Familiarity with Agile methodologies and best practices for product development and delivery with a handson approach to iterative development and prioritization <p> <li> <li> <p> <strong> Stakeholder Management <strong> Partners with functional engineering and product executives across the company including but not limited to collaboration with Product Marketing Sales Customer Success Partners and Professional Service teams to ensure that customer requirements are fully met And influences future business strategy at the leadership and executive levels <p> <li> <ul> <p> <strong> People Leadership <strong> <em> Builds a strong and inclusive organization with high levels of employee engagement by attracting and developing talent and rewarding highperforming teams and individuals <em> <p> <ul> <li> <p> Provides employees with coaching feedback and developmental opportunities to enhance their skills motivation and performance <p> <li> <li> <p> Maintains an atmosphere of respect mutual support flexibility continuous learning good humor and commitment to business goals and customer needs to fulfill the company vision <p> <li> <li> <p> Rewards high performing employees and teams in ways that enhance employee engagement commitment and satisfaction <p> <li> <li> <p> Establishes and maintains relationships and effectively communicates with customers and senior management to raise visibility and ensure collaboration with appropriate key stakeholders <p> <li> <li> <p> Manages operations staffing including recruitment supervision scheduling development evaluation and disciplinary actions <p> <li> <ul> <p> <strong> What Youll Need <strong> Minimum qualifications <p> <ul> <li> <p> 15+ years of progressive relevant experience in product management preferably in the B2B software development or technology areas related to data acquisition storage reporting and disclosure <p> <li> <li> <p> Undergraduate Degree or equivalent combination of education and experience in a related field <p> <li> <ul> <p> <p> <p> Preferred qualifications <p> <ul> <li> <p> An understanding of the regulatory and business issues related to sustainability of the environmental social and governance ESG space is valued <p> <li> <li> <p> 7+ years of people management experience including leading directors and managers in a product organization <p> <li> <li> <p> Proven success driving product strategy and product releases in a comparable environment or direct software development environment <p> <li> <li> <p> MBA preferred <p> <li> <li> <p> Knowledge and experience working in an Agile development environment a plus <p> <li> <li> <p> Expertise in product development from conception to market successfully defining and delivering complex software products through the entire product lifecycle <p> <li> <li> <p> Proven track record of leading and developing high performing product teams <p> <li> <li> <p> Ability to collaborate with and influence executive leadership <p> <li> <li> <p> Strong communication and interpersonal skills to collaborate across the organization with all levels of leadership and management <p> <li> <li> <p> Entrepreneurial experience managing multiple functions of an operation <p> <li> <ul> <p> <p> <p> Working Conditions amp Travel Requirements <p> <ul> <li> <p> Reliable internet access for any period of time working remotely not in a Workiva office <p> <li> <li> <p> Up to 25 travel and occasionally more during product launches <p> <li> <ul> <p> <p> <p> <strong> How Youll Be Rewarded <strong> <p> <p> <p> <p> ✅ Salary range in the US $22700000 $30900000 <p> <p> ✅ A discretionary bonus typically paid annually <p> <p> ✅ Restricted Stock Units granted at time of hire <p> <p> ✅ 401k match and comprehensive employee benefits package <p> <p> <p> <p> The salary range represents the low and high end of the salary range for this job in the US Minimums and maximums may vary based on location The actual salary offer will carefully consider a wide range of factors including your skills qualifications experience and other relevant factors <p> <p> <p> <p> <strong> Where Youll Work <strong> <p> <p> <p> <p> Our values drive how we work and who we hire You will see these values ingrained in how we support our customers work with team members build our products and in the work environment weve created <p> <p> <p> <p> We believe our people are our greatest asset and our unique culture gives employees the opportunity to make an impact everyday We give our employees the freedom and resources they needbacked by our culture of collaboration and diverse thoughtto continue innovating and breaking new ground We hire talented people with a wide range of skills and experiences who are eager to tackle some of todays most challenging problems <p> <p> <p> <p> At Workiva youll enjoy <p> <ul> <li> <p> <strong> Fantastic Benefits <strong> With coverage starting day one choose from competitive health dental and vision plans on the largest physician networks available <p> <li> <li> <p> <strong> Casual Dress <strong> Workiva has a casual work environment most people wear jeans to the office <p> <li> <li> <p> <strong> Involvement <strong> Ability to participate in Business Employee Resource Groups Black Hispanic Asian Women Rainbow LGBTQIA+ Veterans Disabilities Volunteering Company wide celebrations and more <p> <li> <li> <p> <strong> Worklife Balance <strong> We have competitive PTO VTO and Parental Leave We encourage employees to spend time enjoying life outside of work <p> <li> <ul> <p> <strong> Learn more about life at Workiva <strong> <a class=fontbold underline fontbold underline fontbold underline href=httpswwwlinkedincomcompanyworkiva rel=noopener noreferrer nofollow target=blank> httpswwwlinkedincomcompanyworkiva <a> <p> <p> <strong> Learn more about benefits <strong> <a class=fontbold underline fontbold underline fontbold underline href=httpswwwworkivacomcareersbenefits rel=noopener noreferrer nofollow target=blank> httpswwwworkivacomcareersbenefits <a> <p> <p> Workiva is an Equal Employment Opportunity and Affirmative Action Employer We believe that great minds think differently We value diversity of backgrounds beliefs and interests and we recognize diversity as an important source of intellectual thought varied perspective and innovation Employment decisions are made without regard to age race creed color religion sex national origin ancestry disability status veteran status sexual orientation gender identity or expression genetic information marital status citizenship status or any other protected characteristic We strongly encourage and welcome people from historically marginalized groups to apply <p> <p> <p> <p> Workiva is committed to working with and providing reasonable accommodations to applicants with disabilities To request assistance with the application process please email <a class=fontbold underline fontbold underline fontbold underline href=mailtotalentacquisitionworkivacom rel=noopener noreferrer nofollow target=blank> <u> talentacquisitionworkivacom <u> <a> <p> <p> Workiva employees are required to undergo comprehensive security and privacy training tailored to their roles ensuring adherence to company policies and regulatory standards <p> <p> <p> <p> <em> Workiva supports employees in working where they work best either from an office or remotely from any location within their country of employment <em> <p> <p> LILP1 <p><p>
Machine Learning Engineer (L3)
Company: Twilio
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <h3> <strong> See yourself at Twilio <strong> <h3> <p> Join the team as Twilios next Machine Learning Engineer L3 on the Data Services and Throughput team <p> <h3> <strong> Who we are amp why were hiring <strong> <h3> <p> Twilio powers realtime business communications and data solutions that help <a class=fontbold underline fontbold underline fontbold underline href=httpscustomerstwiliocom rel=noopener noreferrer nofollow target=blank> companies and developers worldwide <a> build better applications and customer experiences <p> <p> Although were headquartered in San Francisco we have presence throughout South America Europe Asia and Australia Were on a journey to becoming a global company that actively opposes racism and all forms of oppression and bias At Twilio we support <a class=fontbold underline fontbold underline fontbold underline href=httpswwwtwiliocomcompanydiversity rel=noopener noreferrer nofollow target=blank> diversity equity amp inclusion <a> wherever we do business <p> <h3> <strong> About the job <strong> <h3> <p> This position is needed to to drive the innovation and creation of cuttingedge products that serve the needs of developers builders and operators You will be a crucial bridge between Product and Design tasked with developing evaluating and maintaining scalable Machine Learning models within lowlatency for realtime applications Your collaboration and expertise will be fundamental in delivering robust solutions that power our users success You will be closely working with a crossfunctional team of engineers architects product UIUX and partners to develop ML and data driven algorithm aspects of customer facing products in Twilio Communication applications <p> <p> Twilio Communications is the leading software for sending messages programmatically The Data Services and Throughput organization builds AIenabled capabilities that separate Twilio from its competitors in messaging capabilities <p> <h3> <strong> Responsibilities <strong> <h3> <p> In this role youll <p> <ul> <li> <p> Build and maintain scalable high quality machine learning solutions in production <p> <li> <li> <p> Design and implement tools and procedures to evaluate performance and accuracy of models and data <p> <li> <li> <p> Work closely with software engineers build tools to enhance productivity and to ship and maintain ML models <p> <li> <li> <p> Demonstrate endtoend understanding of applications and why behind models amp systems and develop high quality MLbased software at scale <p> <li> <li> <p> Truly own the product you work on Be responsible for SLA on call incident resolution customer feedback and participate in blameless postmortems to make our products better <p> <li> <li> <p> Partner with product managers tech leads and stakeholders to analyze business problems clarify requirements and define the scope of the systems and leverage stateoftheart Statistics Machine Learning Deep Learning and Gen AI to address the business problems <p> <li> <li> <p> Drive high engineering standards on the team through code review automated testing and mentoring <p> <li> <li> <p> Collaborate and brainstorm product ideas with product managers designers and engineers <p> <li> <ul> <h3> <strong> Qualifications <strong> <h3> <p> Not all applicants will have skills that match a job description exactly Twilio values diverse experiences in other industries and we encourage everyone who meets the required qualifications to apply While having desired qualifications make for a strong candidate we encourage applicants with alternative experiences to also apply If your career is just starting or hasnt followed a traditional path dont let that stop you from considering Twilio We are always looking for people who will bring something new to the table <p> <p> <strong> Required <strong> <p> <ul> <li> <p> 4+ years of applied ML experience <p> <li> <li> <p> Strong background in the foundations of machine learning and building blocks of modern deep learning <p> <li> <li> <p> Proficiency in Python or Java and familiarity with design patterns <p> <li> <li> <p> Track record of building shipping and maintaining machine learning models in production <p> <li> <li> <p> Extensive experience in technologies such as PyTorch Tensorflow Scikitlearn Spacy NLTK application frameworks eg Flask <p> <li> <li> <p> Deep understanding of ML model implementation cycle eg feature engineering trainingserving AB test model selection etc algorithms eg xgboost time series models deep learning graph neural networks optimization and domains eg forecasting personalization and recommendation system NLP embedding representation <p> <li> <li> <p> Familiarity with MLOps concepts related and maintaining models in production such as testing versioning model registry retraining and monitoring <p> <li> <li> <p> Demonstrated ability to ramp up understand and operate effectively in new application business domains <p> <li> <li> <p> Good written and verbal communication skills You are confident in writing down and presenting your designs and decisions throughout the development lifecycle You are also comfortable providing and receiving feedback in an Agile environment <p> <li> <ul> <p> <strong> Desired <strong> <p> <ul> <li> <p> Experience in recommendation systems forecasting models NLP techniques embedding representation approaches and statistical models <p> <li> <li> <p> Experience with Retrieval Augmented Generation Large Language Models and prompt engineering <p> <li> <li> <p> Knowledge of Java and system design concepts <p> <li> <li> <p> Understanding of Experience with CICD pipelines and automated deployment processes <p> <li> <li> <p> Experience with either AWS Azure or Google Cloud and technologies such as Spark Kafka Kubeflow GPU <p> <li> <ul> <h3> <strong> Location <strong> <h3> <p> This role will be and based in the US but is not eligible to be hired in NY WA CT CA and PA <p> <h3> <strong> Travel <strong> <h3> <p> We prioritize connection and opportunities to build relationships with our customers and each other For this role you may be required to travel occasionally to participate in project or team inperson meetings <p> <h3> <strong> What We Offer <strong> <h3> <p> There are many benefits to working at Twilio including in addition to competitive pay things like generous timeoff ample parental and wellness leave healthcare a retirement savings program and much more Offerings vary by location <p> <h3> <strong> Twilio thinks big Do you <strong> <h3> <p> We like to solve problems take initiative pitch in when needed and are always up for trying new things Thats why we seek out colleagues who embody our values something we call <a class=fontbold underline fontbold underline fontbold underline href=httpswwwtwiliocomcompanyvalues rel=noopener noreferrer nofollow target=blank> Twilio Magic <a> Additionally we empower employees to build <a class=fontbold underline fontbold underline fontbold underline href=httpstwilioorgsupportandresourcesimpactfund rel=noopener noreferrer nofollow target=blank> positive change in their communities <a> by supporting their volunteering and donation efforts <p> <p> So if youre ready to unleash your full potential do your best work and be the best version of yourself apply now <p> <p> If this role isnt what youre looking for <a class=fontbold underline fontbold underline fontbold underline href=httpswwwtwiliocomcompanyjobsopenpositions rel=noopener noreferrer nofollow target=blank> please consider other open positions <a> <p> <p> <em> Please note this role is open to candidates outside of Colorado California New York and Washington The information below is provided for candidates hired in those locations only <em> <p> <p> The estimated pay ranges for this role are as follows <p> <ul> <li> <p> Based in Colorado $13500 $169000 <p> <li> <li> <p> This role may be eligible to participate in Twilios equity plan and corporate bonus plan All roles are eligible for the following benefits health care insurance 401k retirement account paid sick time paid personal time off paid parental leave <p> <li> <ul> <p> The successful candidates starting salary will be determined based on permissible nondiscriminatory factors such as skills experience and geographic location within the state <p> <p> <strong> Twilio is proud to be an equal opportunity employer <strong> Twilio is proud to be an Equal Employment Opportunity and Affirmative Action employer We do not discriminate based upon race religion color national origin sex including pregnancy childbirth reproductive health decisions or related medical conditions sexual orientation gender identity gender expression age status as a protected veteran status as an individual with a disability genetic information political views or activity or other applicable legally protected characteristics We also consider qualified applicants with criminal histories consistent with applicable federal state and local law Additionally Twilio participates in the EVerify program in certain locations as required by law <p> <p> Twilio is committed to providing reasonable accommodations for qualified individuals with disabilities and disabled veterans in our job application procedures If you need assistance or an accommodation due to a disability please contact us at accommodationtwiliocom <p><p>
Software Technical Program Manager
Company: Groq
Location: USA
Posted Apr 29, 2024
Groq is a company that envisions an AI economy powered by human agency, aiming to make AI accessible to all. They believe the current GPU technology is limiting AI applications and have introduced the Language Processing Unit (LPU) Inference Engine, which outperforms GPUs in speed, power, efficiency, and cost-effectiveness. The company is hiring a Software Technical Program Manager to guide software teams, improve collaboration between development and production teams, and work cross-functionally with hardware teams. The ideal candidate should be self-motivated, have experience in software engineering, and be comfortable working in a dynamic environment. Groq values diversity and inclusion, offering competitive compensation and benefits.
HR Systems Administrator
Company: Clipboard Health
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <h3> <strong> About The Team <strong> <h3> <p> Were not your typical People Operations team We arent focused on writing policies or telling people what they cant do we work on solving tough problems like the right cadence and approach for feedback and sourcing hiring and developing an allstar team If you ask anyone here what they think about our team we will hope they would say They enforce high standards across the org they are my goto for leadership development and They are some of the most strategic thinkers and problem solvers in the org <p> <h3> <strong> About the Role <strong> <h3> <p> We are seeking our first HR Systems Administrator to join our People Operations team This hire will be responsible for owning all IT tech and platform security responsibilities for the People Operations team This includes managing platform onboarding and offboarding maintaining SSO integration with our HRIS Rippling fielding and triaging tech requests and serving as the primary point person with other departments such as Security and Workforce Management teams The ideal addition to our team is a proactive problem solver The person will also be skilled at evaluating and identifying the most effective tools and methods to keep our People Operations running smoothly They will take ownership of these solutions implementing them to ensure our success <p> <h3> <strong> Main Job Duties <strong> <h3> <ul> <li> <p> Evaluate and troubleshoot team members tech needs and provide solutions remotely via video Slack or through our support desk <p> <li> <li> <p> Respond to inbound support desk tickets and inquiries and provide technical assistance to team members including app provisioning and troubleshooting <p> <li> <li> <p> Understand organise and manage permissions across different platforms including Rippling Google Workspace and custom vendors <p> <li> <li> <p> Help configure integrations for our IT systems including SAML SCIM and customer webhooks and workflows <p> <li> <li> <p> Identify and solve tech problems efficiently and effectively while maintaining a positive demeanour and attitude <p> <li> <li> <p> Manage all platform onboarding and offboarding relating to People Operations applications and tools <p> <li> <li> <p> Maintain SSO integration process with our HRIS Rippling <p> <li> <li> <p> Work with People Operations on data analytics projects <p> <li> <ul> <p> Nice to have <p> <ul> <li> <p> Familiarity with Salesforce Salesloft Github Rippling <p> <li> <li> <p> Familiarity with the Jira help desk ticketing system <p> <li> <ul> <h3> <strong> Some of the current People Operations projects you may support <strong> <h3> <p> People Operations Systems and Platform Security <p> <ul> <li> <p> Moving to SSO across all possible platforms to enhance security <p> <li> <li> <p> Ensuring full utilisation of all paid platforms <p> <li> <li> <p> Ensuring managers have the necessary data about their team to understand both historical data and current trends <p> <li> <ul> <h3> <strong> Experience <strong> <h3> <p> <strong> Need to Have Skills <strong> <p> <ul> <li> <p> At least 2 years working in Information Technology or a similar field <p> <ul> <li> <p> A bachelors degree or equivalent certification is helpful but not required <p> <li> <ul> <li> <li> <p> Ability to effectively write standard operating procedures SOPs and maintain documentation <p> <li> <li> <p> Ability to work with confidential information and situations with professionalism <p> <li> <li> <p> Familiarity with languages like Terraform HCL and YAML <p> <li> <li> <p> Ability to manage DNS and email settings <p> <li> <li> <p> Skilled at communication and collaboration to build trust with colleagues across teams <p> <li> <li> <p> Ability to make decisions independently as well as effectively explain the decisionmaking process to a team <p> <li> <li> <p> Excellent organisational and time management skills <p> <li> <li> <p> Experience with Google Suite and Super Admin privileges <p> <li> <ul> <p> <strong> Need to Have Values <strong> <p> <ul> <li> <p> <strong> <em> First Principles Thinking <em> <strong> We dont follow suit and build what others are building we build something new and better We work backward from data feedback and information to create the best solution possible even if it means starting over from scratch We dont do something because its what we have always done or because some person or book told us we should we do the best thing even if its hard and uncomfortable <p> <ul> <li> <p> <strong> <em> Judgment <em> <strong> You arent afraid to make decisions and exercise independent judgment and when you do you are usually right This doesnt mean you cant ever make a mistake but it does mean that you are above average when it comes to making judgment calls <p> <li> <li> <p> <strong> <em> Initiative and Resourcefulness <em> <strong> When you see an issue you jump in and fix it When you dont know where to start you lean on your intuition and judgment and just start somewhere You work independently to achieve your goals and pull in other members of the team when necessary You are resourceful in finding answers and solutions on your own whenever possible because that is how you learn and grow <p> <li> <li> <p> <strong> <em> Integrity <em> <strong> You do not share the confidential and sensitive information you have access to with others unless given permission and you never use that information for your own gain Were intellectually honest and when we make mistakes we raise them as quickly as possible <p> <li> <li> <p> <strong> <em> Ownership <em> <strong> While you may be assigned a specific task or responsibility you have a high sense of ownership over everything that touches People Ops When you see an issue you either take ownership of fixing it yourself or you find the best person to fix it and flag it to them We own our work to the fullest and the buck stops with us <p> <li> <ul> <li> <ul> <h3> <strong> Salary <strong> <h3> <p> $50000 $100000 depending on location and experience <p> <p> Please note This position is exclusively open to individuals legally authorised to work within the United States <p><p>
Performance Marketing Channel Manager - Email | SMS
Company: Stio
Location: USA
Posted Apr 29, 2024
Stio is an outdoor mountain brand based in Jackson, Wyoming, known for its functional and innovative apparel, footwear, and accessories. The company is committed to sustainability, partnering with organizations like Protect Our Winters and the Conservation Alliance. Stio is seeking a Performance Marketing Channel Manager - Email | SMS to drive customer acquisition, retention, and revenue through email and SMS marketing. The role involves setting and achieving channel marketing goals, analyzing retention metrics, and collaborating with various teams to develop and deliver multi-channel marketing programs. The ideal candidate should have 3+ years of email or related channel management experience, proficiency in Microsoft Office and Google products, and a strong understanding of Klaviyo or similar email platforms.
Senior Backend Engineer - Styles
Company: Webflow
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> At Webflow our mission is to bring development superpowers to everyone Webflow is the leading visual development platform for building powerful websites without writing code By combining modern web development technologies into one platform Webflow enables people to build websites visually saving engineering time while clean code seamlessly generates in the background From independent designers and creative agencies to Fortune 500 companies millions worldwide use Webflow to be more nimble creative and collaborative Its the web made better <p> <p> The Styles team is responsible for building and investing in the design capabilities of our core product to empower millions of designers worldwide to easily adopt Webflow to build manage and scale any number of sites efficiently <p> <p> Were looking for a Senior Backend Engineer to join the Styles team and lead the team to deliver impactful features for our customers to build highly personalized web experiences In this role you will execute the technical direction and be a mentor amp partner to other engineers on the team Additionally you will help lead crossfunctional efforts to drive even greater impact <p> <h2> <strong> About the role <strong> <h2> <ul> <li> <p> Location Remotefirst United States BC amp ON Canada <p> <li> <li> <p> Fulltime <p> <li> <li> <p> Permanent <p> <li> <li> <p> Exempt US Candidates <p> <li> <li> <p> Reporting to the Engineering Manager of Designer UX team <p> <li> <li> <p> The cash compensation for this role is tailored to align with the cost of labor in different geographic markets Weve structured the base pay ranges for this role into zones for our geographic markets and the specific base pay within the range will be determined by the candidates geographic location jobrelated experience knowledge qualifications and skills <p> <ul> <li> <p> Zone A $162500 $216050 <p> <li> <li> <p> Zone B $152700 $203100 <p> <li> <li> <p> Zone C $143000 $190150 <p> <li> <ul> <ul> <li> <p> CAD 184600 CAD 245500 <p> <li> <ul> <ul> <li> <p> United States all figures cited below in USD and pertain to workers in the United States <p> <li> <li> <p> Canada All figures cited below in CAD and pertain to workers in ON amp BC Canada <p> <li> <ul> <li> <ul> <p> Please visit our <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowaboutwebflowiocareers rel=noopener noreferrer nofollow target=blank> Careers page <a> for more information on which locations are included in each of our geographic pay zones However please confirm the zone for your specific location with your recruiter <p> <p> As a Senior Backend Engineer youll <p> <ul> <li> <p> Design and implement scalable backend services <p> <li> <li> <p> Drive crosspillar collaboration with software engineers product managers designers and QA analysts in an autonomous supportive team environment <p> <li> <li> <p> Effectively communicate team priorities and strategy to engineering and crossfunctional leadership teams <p> <li> <li> <p> Build and maintain unit and integration tests <p> <li> <li> <p> Provide clarity on processes and priorities to crosspillar partners and other engineers on the team <p> <li> <li> <p> Mentor other engineers on best practices code design considerations and quality <p> <li> <ul> <p> In addition to the responsibilities outlined above at Webflow we will support you in identifying where your interests and development opportunities lie and well help you incorporate them into your role <p> <h2> <strong> About you <strong> <h2> <p> Youll thrive as a Senior Backend Engineer Styles if you <p> <ul> <li> <p> Have 5+ years of experience in scalable multitenant environments <p> <li> <li> <p> Have 2+ years experience working with feature teams on customerfacing products shipping and iterating to solve customer problems <p> <li> <li> <p> Value testing and documentation equally as much as your code <p> <li> <li> <p> Are comfortable with ambiguity and scoping solutions with your teammates <p> <li> <li> <p> Are comfortable working on JavascriptTypescript MongoDB and Node <p> <li> <li> <p> Have consistently communicated trade offs throughout a project to meet both technical and business requirements <p> <li> <li> <p> Enjoy highvisibility work and presenting to executive counterparts <p> <li> <li> <p> Get excited about encouraging and developing other engineers <p> <li> <ul> <p> Even if you dont meet 100 of the above qualifications you should still seriously consider applying Research shows that you may still be considered for a role if you meet just half of the requirements <p> <p> <strong> Our Core Behaviors <strong> <p> <ul> <li> <p> <strong> Obsess over customer experience <strong> We deeply understand what were building and who were building for and serving We define the leading edge of whats possible in our industry and deliver the future for our customers <p> <li> <li> <p> <strong> Move with heartfelt urgency <strong> We have a healthy relationship with impatience channeling it thoughtfully to show up better and faster for our customers and for each other Time is the most limited thing we have and we make the most of every moment <p> <li> <li> <p> <strong> Say the hard thing with care <strong> Our best work often comes from intelligent debate critique and even difficult conversations We speak our minds and dont sugarcoat things and we do so with respect maturity and care <p> <li> <li> <p> <strong> Make your mark <strong> We seek out new and unique ways to create meaningful impact and we champion the same from our colleagues We work as a team to get the job done and we go out of our way to celebrate and reward those going above and beyond for our customers and our teammates <p> <li> <ul> <h3> <strong> Benefits amp wellness <strong> <h3> <ul> <li> <p> Equity ownership RSUs in a growing privatelyowned company <p> <li> <li> <p> 100 employerpaid healthcare vision and dental insurance coverage for employees and dependents fulltime employees working 30+ hours per week as well as Health Savings AccountHealth Reimbursement Account dependent care Flexible Spending Account US only dependent on insurance plan selection where applicable in the respective country of employment Employees may also have voluntary insurance options such as life disability hospital protection accident and critical illness where applicable in the respective country of employment <p> <li> <li> <p> 12 weeks of paid parental leave for both birthing and nonbirthing caregivers as well as an additional 68 weeks of pregnancy disability for birthing parents to be used before child bonding leave where local requirements are more generous employees receive the greater benefit Employees also have access to family planning care and reimbursement <p> <li> <li> <p> Flexible PTO with a mandatory annual minimum of 10 days paid time off for all locations where local requirements are more generous employees receive the greater benefit and sabbatical program <p> <li> <li> <p> Access to mental wellness and professional coaching therapy and Employee Assistance Program <p> <li> <li> <p> Monthly stipends to support health and wellness smart work and professional growth <p> <li> <li> <p> Professional career coaching internal learning amp development programs <p> <li> <li> <p> 401k plan and pension schemes in countries where statutorily required financial wellness benefits like CPA or financial advisor coverage <p> <li> <li> <p> Discounted Pet Insurance offering US only <p> <li> <li> <p> Commuter benefits for inoffice employees <p> <li> <ul> <p> <em> Temporary employees are not eligible for paid holiday time off accrued paid time off paid leaves of absence or companysponsored perks unless otherwise required by law <em> <p> <h3> <strong> Be you with us <strong> <h3> <p> At Webflow equality is a core tenet of our culture We are an Equal Opportunity EEOVeteransDisabled Employer and are <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomdiversityequityinclusion rel=noopener noreferrer nofollow target=blank> committed <a> to building an inclusive global team that represents a variety of backgrounds perspectives beliefs and experiences Employment decisions are made on the basis of jobrelated criteria without regard to race color religion sex sexual orientation gender identity national origin disability veteran status or any other classification protected by applicable law Pursuant to the San Francisco Fair Chance Ordinance Webflow will consider for employment qualified applicants with arrest and conviction records <p> <h3> <strong> Stay connected <strong> <h3> <p> Not ready to apply but want to be part of the Webflow community Consider following our story on our <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomblog rel=noopener noreferrer nofollow target=blank> Webflow Blog <a> <a class=fontbold underline fontbold underline fontbold underline href=httpswwwlinkedincomcompanywebflowinc rel=noopener noreferrer nofollow target=blank> LinkedIn <a> <a class=fontbold underline fontbold underline fontbold underline href=httpstwittercomwebflow rel=noopener noreferrer nofollow target=blank> X Twitter <a> andor <a class=fontbold underline fontbold underline fontbold underline href=httpswwwglassdoorcomReviewsWebflowReviewsE890506htm rel=noopener noreferrer nofollow target=blank> Glassdoor <a> <p> <h3> <strong> Please note <strong> <h3> <p> <em> We will ensure that individuals with disabilities are provided reasonable accommodation to participate in the job application or interview process to perform essential job functions and to receive other benefits and privileges of employment Upon interview scheduling instructions for confidential accommodation requests will be administered <em> <p> <p> <em> To join Webflow youll need a valid right to work authorization depending on the country of employment <em> <p> <p> <em> If you are extended an offer that offer may be contingent upon your successful completion of a background check which will be conducted in accordance with applicable laws We may obtain one or more background screening reports about you solely for employment purposes <em> <p> <p> <em> For information about how Webflow processes your personal information please review <em> <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomlegalapplicantprivacynotice rel=noopener noreferrer nofollow target=blank> <em> Webflows Applicant Privacy Notice <em> <a> <em> <em> <p><p>
Director, Product Design
Company: Thumbtack
Location: USA
Posted Apr 30, 2024
Thumbtack is a virtual-first company that provides an app for homeowners to manage their homes, offering services such as home repairs and maintenance. The company is growing rapidly in a $600B+ industry, with a valuation of $3.2 billion as of June 2021. Thumbtack is seeking a design leader with 6+ years of experience to lead the Marketplace pillar, collaborating with cross-functional teams to envision and deliver user experiences. The company offers competitive salaries, a virtual-first working model, and various benefits, including in-person events, company-wide holidays, and an Employee Assistance Program for mental health and well-being.