Notify Interested Applicants Jobs in USA
395,270 open positions · Updated daily
Looking for Notify Interested Applicants jobs in USA? Browse our curated listings with transparent salary information to find the perfect Notify Interested Applicants position in the USA area.
Senior Backend Engineer - Shared Services
Company: Webflow
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> At Webflow our mission is to bring development superpowers to everyone Webflow is the leading visual development platform for building powerful websites without writing code By combining modern web development technologies into one platform Webflow enables people to build websites visually saving engineering time while clean code seamlessly generates in the background From independent designers and creative agencies to Fortune 500 companies millions worldwide use Webflow to be more nimble creative and collaborative Its the web made better <p> <p> We are looking for a Senior Backend Engineer to join the Shared Services team to enable our engineering team to build more efficiently so we can further our mission of bringing visual development superpowers to everyone If youre passionate about engineering excellence and driving operational efficiency wed love to hear from you <p> <h2> <strong> About the role <strong> <h2> <ul> <li> <p> Location Remotefirst United States BC amp ON Canada <p> <li> <li> <p> Fulltime <p> <li> <li> <p> Permanent <p> <li> <li> <p> Exempt <p> <li> <li> <p> The cash compensation for this role is tailored to align with the cost of labor in different geographic markets Weve structured the base pay ranges for this role into zones for our geographic markets and the specific base pay within the range will be determined by the candidates geographic location jobrelated experience knowledge qualifications and skills <p> <ul> <li> <p> United States all figures cited below in USD and pertain to workers in the United States <p> <ul> <li> <p> Zone A $162500 $216050 <p> <li> <li> <p> Zone B $152700 $203100 <p> <li> <li> <p> Zone C $14300 $190150 <p> <li> <ul> <li> <li> <p> Canada All figures cited below in CAD and pertain to workers in ON amp BC Canada <p> <ul> <li> <p> CAD 184600 CAD 245500 <p> <li> <ul> <li> <ul> <li> <li> <p> Please visit our <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowaboutwebflowiocareers rel=noopener noreferrer nofollow target=blank> Careers page <a> for more information on which locations are included in each of our geographic pay zones However please confirm the zone for your specific location with your recruiter <p> <li> <li> <p> Reporting to the engineering manager <p> <li> <ul> <p> As Senior Backend Engineer youll <p> <ul> <li> <p> Develop a comprehensive knowledge of how areas of business such as architecture and infrastructure integrate to improve developer productivity and accomplish our business goals <p> <li> <li> <p> Collaborate with software engineers product managers designers and QA analysts in an autonomous supportive team environment <p> <li> <li> <p> Build and maintain shared services including but not limited to Inapp Email Notification platform and Feature Flag framework <p> <li> <li> <p> Identify develop and document APIs for Webflows service catalog as well as provide quick start guides for developer best practices <p> <li> <li> <p> Solve problems in a highly technical platform that empowers hundreds of engineers <p> <li> <li> <p> Improve our planning development and deployment processes to help you and your fellow team members <p> <li> <li> <p> Mentor coach and inspire a team of engineers of various levels <p> <li> <ul> <p> In addition to the responsibilities outlined above at Webflow we will support you in identifying where your interests and development opportunities lie and well help you incorporate them into your role <p> <h2> <strong> About you <strong> <h2> <p> Youll thrive in this role if you <p> <ul> <li> <p> Have 5+ years developing and deploying web applications with a proven track record of shipping to market <p> <li> <li> <p> Excellent organization and communication skills both verbal and written <p> <li> <li> <p> Have worked on complex issues where the analysis requires an indepth knowledge of the company and existing architecture <p> <li> <li> <p> Can debug production issues across services and multiple levels of the stack <p> <li> <li> <p> Take pride in taking ownership and driving projects to business impact <p> <li> <li> <p> Proven experience building complex web systems <p> <li> <li> <p> Are familiar with one or more Javascript type systems we use TypeScript here <p> <li> <li> <p> Are comfortable working in an agile safetofail environment <p> <li> <ul> <p> <strong> Our Core Behaviors <strong> <p> <ul> <li> <p> <strong> Obsess over customer experience <strong> We deeply understand <em> what <em> were building and <em> who <em> were building for and serving We define the leading edge of whats possible in our industry and deliver the future for our customers <p> <li> <li> <p> <strong> Move with heartfelt urgency <strong> We have a healthy relationship with impatience channeling it thoughtfully to show up better and faster for our customers and for each other Time is the most limited thing we have and we make the most of every moment <p> <li> <li> <p> <strong> Say the hard thing with care <strong> Our best work often comes from intelligent debate critique and even difficult conversations We speak our minds and dont sugarcoat things and we do so with respect maturity and care <p> <li> <li> <p> <strong> Make your mark <strong> We seek out new and unique ways to create meaningful impact and we champion the same from our colleagues We work as a <em> team <em> to get the job done and we go out of our way to celebrate and reward those going above and beyond for our customers and our teammates <p> <li> <ul> <h3> <strong> Benefits amp wellness <strong> <h3> <ul> <li> <p> Equity ownership RSUs in a growing privatelyowned company <p> <li> <li> <p> 100 employerpaid healthcare vision and dental insurance coverage for employees and dependents fulltime employees working 30+ hours per week as well as Health Savings AccountHealth Reimbursement Account dependent care Flexible Spending Account US only dependent on insurance plan selection where applicable in the respective country of employment Employees may also have voluntary insurance options such as life disability hospital protection accident and critical illness where applicable in the respective country of employment <p> <li> <li> <p> 12 weeks of paid parental leave for both birthing and nonbirthing caregivers as well as an additional 68 weeks of pregnancy disability for birthing parents to be used before child bonding leave where local requirements are more generous employees receive the greater benefit Employees also have access to family planning care and reimbursement <p> <li> <li> <p> Flexible PTO with a mandatory annual minimum of 10 days paid time off for all locations where local requirements are more generous employees receive the greater benefit and sabbatical program <p> <li> <li> <p> Access to mental wellness and professional coaching therapy and Employee Assistance Program <p> <li> <li> <p> Monthly stipends to support health and wellness smart work and professional growth <p> <li> <li> <p> Professional career coaching internal learning amp development programs <p> <li> <li> <p> 401k plan and pension schemes in countries where statutorily required financial wellness benefits like CPA or financial advisor coverage <p> <li> <li> <p> Discounted Pet Insurance offering US only <p> <li> <li> <p> Commuter benefits for inoffice employees <p> <li> <ul> <h3> <strong> Be you with us <strong> <h3> <p> At Webflow equality is a core tenet of our culture We are an Equal Opportunity EEOVeteransDisabled Employer and are <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomdiversityequityinclusion rel=noopener noreferrer nofollow target=blank> committed <a> to building an inclusive global team that represents a variety of backgrounds perspectives beliefs and experiences Employment decisions are made on the basis of jobrelated criteria without regard to race color religion sex sexual orientation gender identity national origin disability veteran status or any other classification protected by applicable law Pursuant to the San Francisco Fair Chance Ordinance Webflow will consider for employment qualified applicants with arrest and conviction records <p> <h3> <strong> Stay connected <strong> <h3> <p> Not ready to apply but want to be part of the Webflow community Consider following our story on our <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomblog rel=noopener noreferrer nofollow target=blank> Webflow Blog <a> <a class=fontbold underline fontbold underline fontbold underline href=httpswwwlinkedincomcompanywebflowinc rel=noopener noreferrer nofollow target=blank> LinkedIn <a> <a class=fontbold underline fontbold underline fontbold underline href=httpstwittercomwebflow rel=noopener noreferrer nofollow target=blank> X Twitter <a> andor <a class=fontbold underline fontbold underline fontbold underline href=httpswwwglassdoorcomReviewsWebflowReviewsE890506htm rel=noopener noreferrer nofollow target=blank> Glassdoor <a> <p> <h3> <strong> Please note <strong> <h3> <p> <em> To join Webflow youll need valid US or Canadian work authorization depending on the country of employment <em> <p> <p> <em> If you are extended an offer that offer may be contingent upon your successful completion of a background check which will be conducted in accordance with applicable laws We may obtain one or more background screening reports about you solely for employment purposes <em> <p> <p> <em> For information about how Webflow processes your personal information please review <em> <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomlegalapplicantprivacynotice rel=noopener noreferrer nofollow target=blank> <em> Webflows Applicant Privacy Notice <em> <a> <em> <em> <p> <p> <p><p>
Senior Software Engineer - Cosmos Platform
Company: Bishop Fox
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> Bishop Fox is the leading authority in offensive security providing solutions ranging from continuous penetration testing red teaming and attack surface management to product cloud and application security assessments Weve worked with more than a quarter of the Fortune 100 half of the Fortune 10 eight of the top 10 global technology companies and all of the top global media companies Our Cosmos platform service innovation and culture of excellence continue to gather accolades from industry award programs including Fast Company Inc SC Media and others For more than 16 years weve been contributing and giving back to the security community Weve published more than 16 open source tools and 50 security advisories in the last five years alone Learn more at bishopfoxcom or follow us on social media <p> <p> Given our exceptional growth we are expanding and hiring a Software Engineer to join us on this exciting journey At Bishop Fox you will join a company of brilliant technologists to help build THE platform for offensive security Cosmos Working on Cosmos you will have the opportunity to build eventdriven domainoriented services across a wide spectrum of offensive security capabilities Each day will bring new challenges and problems to solve If you have strong experience with modern architecture cloud and languages such as Golang and Python are selfmotivated and enjoy solving problems at scale then the Cosmos Platform Engineering team is for you Bring your experience curiosity and will to deliver great technology and join our Cosmos Platform team <p> <h3> Responsibilities <h3> <p> As a member of the Cosmos Platform Engineering team you will design solutions write code and usher software into production You will build services that industrialize the automation of offensive security processes and provide security information to our customers in a scalable secure reliable cloud platform <p> <p> As a Senior Engineer you will take the lead on design solutions drive quality standards and provide technical leadership to the team and broader engineering organization <p> <h3> Requirements <h3> <ul> <li> <p> 5+ years of software development experience <p> <li> <li> <p> Professional experience with Golang or Python required <p> <li> <li> <p> Mastery in the foundations of Golang or Python and strong experience in building microservices in the specified language <p> <li> <li> <p> Experience in a professional software organization using an SDLC <p> <li> <li> <p> Understanding of coding best practices structure patterns unit tests secure coding etc <p> <li> <li> <p> Ability to work independently and also work together with the team to solve complex technical problems <p> <li> <ul> <h3> Preferred Skills and Experience <h3> <ul> <li> <p> Experience with Amazon Web Services AWS <p> <li> <li> <p> Eventdriven and asynchronous systems Rabbit SQS SNS Kafka Kinesis etc <p> <li> <li> <p> Experience using datastores SQL or NoSQL <p> <li> <li> <p> An interest in cybersecurity <p> <li> <ul> <p> Bishop Fox has always allowed its employees to work remotely and this role could work anywhere in the United States Our comprehensive benefits program is tailored to meet your needs at an affordable price We embrace diversity and an inclusive culture We value our employees and who they are which fosters a powerful and collective talent base to successfully serve our clients and the security community with unparalleled expertise <p> <p> <em> Bishop Fox is an Equal Opportunity employer All qualified applicants will receive consideration for employment without regard to race color religion sex including sexual orientation and gender identity national origin disability protected veteran status or any other characteristic protected by applicable federal state or local law All new hires must pass a background check as a condition of employment <em> <p> <p> Interested Apply today <p><p>
Sr. Technical Recruiter
Company: hims & hers
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <h3> <strong> About the Role <strong> <h3> <p> We are looking for a passionate and organized Remote Sr Technical Recruiter Contract to help us rapidly grow our Technical teams You will make a massive impact on the future of our company and wear many hats from building processes sourcing and closing candidates and working across various business functions Its an incredible time to join the Hims amp Hers team <p> <h3> <strong> You Will <strong> <h3> <ul> <li> <p> Manage full cycle recruiting process kickoff meetings with hiring managers sourcing candidate screens navigate interview loops facilitate panel debriefs offer stage and onboarding handoff <p> <li> <li> <p> Build a pipeline of talent by sourcing candidates across LinkedIn Recruiter internal referrals applicants and new channels <p> <li> <li> <p> Partner closely with leaders including executive leadership in the domains you support <p> <li> <li> <p> Meet weeklybi weekly with hiring managers to provide updates improve process and learn <p> <li> <li> <p> Use datadriven insights to improve recruiting efficiency and influence hiring decisions <p> <li> <li> <p> Obsess on exceptional candidate experience <p> <li> <li> <p> Cultivate a collaborative and constructive team environment exemplifying a lowego highhumility and partnershiporiented approach <p> <li> <ul> <h3> <strong> You Have <strong> <h3> <ul> <li> <p> 8+ years fullcycle technical recruiting for areas in Software Engineering Infrastructure Data and Analytics Product Management Data Science Machine learning and the Mobile domain <p> <li> <li> <p> 5+ years sourcing technical roles on LinkedIn Recruiter <p> <li> <li> <p> Interest to explore new places to source in addition to your goto channels <p> <li> <li> <p> Proven ability to work in a fastpaced environment and manage multiple requisitions simultaneously <p> <li> <li> <p> Experience with applicant tracking systems ATS and recruitment software Greenhouse <p> <li> <li> <p> Excellent communication and interpersonal skills with the ability to build rapport with candidates and hiring teams <p> <li> <ul> <h3> <strong> Our Tech Stack <strong> <h3> <ul> <li> <p> Frontend React React Native Typescript GraphQL <p> <li> <li> <p> Backend Java Kotlin Spring Boot SQL Python <p> <li> <li> <p> Automation Cypress Fastly Postman Javascript <p> <li> <li> <p> Monitoring Logging Datadog Elasticsearch Logstash Kibana <p> <li> <li> <p> Cloud AWS GCP <p> <li> <li> <p> CICD Jenkins CircleCi <p> <li> <li> <p> Database PostgreSQL DBT <p> <li> <li> <p> Containers Docker <p> <li> <ul> <p> <p> <p> <em> LIRemote <em> <p> <p> <p><p>
Director - Corporate FP&A
Company: Icertis
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> With unmatched technology and categorydefining innovation Icertis pushes the boundaries of whats possible with contract lifecycle management CLM The AIpowered analystvalidated Icertis Contract Intelligence ICI platform turns contracts from static documents into strategic advantage by structuring and connecting the critical contract information that defines how an organization runs Today the worlds most iconic brands and disruptive innovators trust Icertis to fully realize the intent of their combined 10 million contracts worth more than $1 trillion in 40+ languages and 93 countries <p> <p> <p> <p> <strong> Who we are <strong> Icertis is the only contract intelligence platform companies trust to keep them out in front now and in the future Our unwavering commitment to contract intelligence is grounded in our FORTE valuesFairness Openness Respect Teamwork and Executionwhich guide all our interactions with employees customers partners and stakeholders Because in our mission to be the contract intelligence platform of the world we believe how we get there is as important as the destination <p> <p> <p> <p> As the Director of FPampA you will play a critical leadership role you will work closely with all of companys functional leaders and bring key market strategic and operational insights that will shape the direction of the company and accelerate its growth You will also play a key role in telling the companys financial story to investors <p> <p> <p> <p> The ideal candidate will have a proven trackrecord of driving business outcomes through keen financial insight and business modeling They will have the ability to create a 360degree financial picture of the business that reflects and influences the companys strategy and be excellent at communicating with senior leaders and executives They will be toolsavvy with experience in creating scalable data and reporting solutions that support a datadriven culture LIRS1 <p> <p> <p> <p> <p> <p> <strong> What you will do <strong> <p> <ul> <li> <p> Formulate a robust 360degree financial picture of the business complete with market insights and operational drivers <p> <li> <li> <p> Develop and maintain the 3year Strategic Planning Model and forecast <p> <li> <li> <p> Deliver Global PampL and cash flow forecasts <p> <li> <li> <p> Drive Annual Planning Process work cross functionally to build and maintain the Annual Financial Plan and Departmental Budgets <p> <li> <li> <p> Build and deliver Business Performance ReportingOperating dashboards <p> <li> <li> <p> Perform strategic business analysis as needed MampA Geo Expansion <p> <li> <li> <p> Prepare financial analyses as needed to help drive improvements in the business Current focus areas include market expansion opportunities competitive benchmarking analyses pricing and strategic financial optimization strategies <p> <li> <li> <p> Partner with Controller to enhance and accelerate the financial reporting process <p> <li> <li> <p> Identifies and implements system and process improvements to increase the efficiency and effectiveness of planning and reporting workflows <p> <li> <li> <p> Prepare communications to Board of Directors <p> <li> <li> <p> Drive investor presentations and supporting analysis <p> <li> <li> <p> Develop a deep understanding of the business metrics with an eye towards understanding the benefits and risks from a financial perspective and helping to manage key business drivers and desired outcomes <p> <li> <li> <p> Play a key role in preparation of critical public financial documents to support the IPO process including working with bankers and supporting the production of investor materials and SEC filings eg S1 <p> <li> <ul> <p> <p> <p> <strong> What you will bring <strong> <p> <ul> <li> <p> 12+ years of experience of working in direct strategic analysis support of all aspects of the business at all areas of the PampL <p> <li> <li> <p> MBACPA or equivalent experience preferred <p> <li> <li> <p> Demonstrated complex modeling experience this is a handson role and managers are expected to directly contribute and lead by example <p> <li> <li> <p> Highly analytical detailoriented with a commitment to creating a highquality product Naturally inquisitive and able to extract information from various sources to identify and understand the underlying issue Not afraid to question results <p> <li> <li> <p> Prior success working in a fastpaced entrepreneurial environment takes initiative and works independently <p> <li> <li> <p> Working knowledge of accounting principles required including revenue recognition amortization and accrual vs cash accounting Must have a general understanding of financial statements <p> <li> <li> <p> Must have exceptional written visual and spoken communication skills <p> <li> <li> <p> Experience in preparing and delivering executive board and investor level communications <p> <li> <li> <p> IPO experience is a plus <p> <li> <li> <p> Must have advanced Excel Netsuite and Powerpoint skills <p> <li> <li> <p> Experience implementing financial analysis and planning tools required <p> <li> <ul> <p> <p> <p> <p> <p> $146000 $219000 a year <p> <p> <em> Pay offered will vary based on jobrelated factors such as location experience training skills and abilities In addition to the base salary and annual bonus target and an equity component is included in the compensation package <em> <p> <p> <strong> What we offer <strong> <p> <p> We are committed to the health and wellbeing of all Icertians their families the communities they live in and our customers This commitment is represented in the Icertis Four Rings of Responsibility Take Care of Self Take Care of Family Take Care of Community and Take Care of Business in that order <p> <p> <p> <p> To support these commitments Icertis offers excellent health and welfare benefits a generous 401k match and a robust paid time off program Here are some of the other reasons <a class=fontbold underline fontbold underline postingslink href=httpswwwicertiscomcompanynewsicertisplacesfirstinwashingtons100bestcompaniestoworkfor rel=noopener noreferrer nofollow target=blank> Icertis Places First in Washingtons 100 Best Companies to Work For | Icertis <a> <p> <p> <p> <p> ● Equity RSUs and shared ownership in the company <p> <p> ● Flexible work environment <p> <p> ● Paid maternity and paternity leave <p> <p> ● 7 Days for Humanity 7 paid volunteer days <p> <p> ● Generous holidays including the 4th of July week off paid <p> <p> ● Free professional and leadership coaching <p> <p> ● Annual personal development allowance <p> <p> <p> <p> Icertis Inc provides Equal Employment Opportunity to all employees and applicants for employment without regard to race color religion gender identity or expression sex sexual orientation national origin age disability genetic information marital status amnesty or status as a covered veteran in accordance with applicable federal state and local laws Icertis Inc complies with applicable state and local laws governing nondiscrimination in employment in every location in which the company has facilities If you are in need of accommodation or special assistance to navigate our website or to complete your application please send an email with your request to <a class=fontbold underline fontbold underline postingslink href=mailtocareersicertiscom rel=noopener noreferrer nofollow target=blank> careersicertiscom <a> or get in touch with your recruiter <p> <p> <p> <p> By submitting your application you acknowledge that you have read Icertiss Privacy Policy <a class=fontbold underline fontbold underline postingslink href=httpswwwicertiscomprivacystatement rel=noopener noreferrer nofollow target=blank> httpswwwicertiscomprivacystatement <a> <p> <p> <p> <p> Icertis is not open to third party solicitation or resumes for our posted FTE positions Resumes received from third party agencies that are unsolicited will be considered complimentary <p><p>
Head of Global Audio
Company: The Athletic Media Company
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> <strong> About Us <strong> <p> <p> <p> <p> The Athletic is a digital sports media company that brings true sports fans closer to the athletes teams and leagues that captivate their attention We serve a multifaceted audience that craves a richer connection and understanding with immersive storytelling and a likeminded community of fans Founded in 2016 and with major operational hubs in San Francisco Los Angeles London and Melbourne we empower a truly global team of more than 600 creators and cover more than 250 professional sports and collegiate teams across the United States Canada and the UK Our newsroom has produced thousands of indepth reports along with more than 120 podcasts and other forms of premium content Put simply The Athletic is at the center of a sports fans universe <p> <p> <p> <p> <p> <p> <strong> About the Role <strong> <p> <p> <p> <p> The Athletic has one of the worlds leading sports podcast networks and we are looking for an industry leader and creative visionary to push our podcasts into its next successful phase The Head of Global Audio will have creative accountability for all The Athletic podcasts in addition to leading the North American and International teams This leader will be tasked with developing the highest quality audio shows that fit The Athletics journalistic sensibility and also can reach large and engaged audiences both evolving existing shows and new Central to this creative success will be the leadership of our audio teams globally pushing their creative capabilities and creating a culture in which their teams can thrive <p> <p> <p> <p> <p> <p> <strong> Responsibilities <strong> <p> <ul> <li> <p> Manage the production and growth teams with regular check in and manage the staff of the entire audio department <p> <li> <li> <p> Partner with leadership to set ambitious goals and manage the team effectively toward those goals with wide latitude in how goals are accomplished <p> <li> <li> <p> Understand where tradeoffs need to happen across shows and be proactive with solutions <p> <li> <li> <p> Build podcasts with a diverse set of hosts and guests <p> <li> <li> <p> Curate formats shows and hosts that will offer subscribers a distinctive high quality and entertaining experience that helps drive commercial revenue <p> <li> <li> <p> Think about properties as franchises and come up with new ways to build audiencepromote network growth <p> <li> <li> <p> Partner with vertical leads across the newsroom to align with and complement our editorial strategy <p> <li> <li> <p> Work with the Managing Editor of video to develop a video strategy around our audio properties that serves as both a complement to audio and a new platform to build original Athletic content <p> <li> <li> <p> Work closely with the commercial team to monetize content and create strong long lasting brand partnerships <p> <li> <li> <p> Serve as the connective tissue between audio production and the heads of all other departments within the company to ensure that the audio teams output is appropriately supported promoted and monetized <p> <li> <li> <p> Develop meaningful relationships with leaders throughout HQ <p> <li> <li> <p> Provide input into the organization of the production team to ensure the team is set up to achieve its ambitious growth targets while staying within budget <p> <li> <ul> <p> <p> <p> <strong> Requirements <strong> <p> <ul> <li> <p> 10+ years of experience producing a national broadcast in an audio or video format <p> <li> <li> <p> A track record when it comes to launching and sustaining successful podcasts or video series <p> <li> <li> <p> Expert knowledge of a wide range of audio formats and distribution channels Has a finger on the pulse of industry trends and can see ahead 1218 months <p> <li> <li> <p> Has a deep understanding of sports with a fluency in how topics are covered and discussed by fans Has an ear for high quality creative output that resonates with listeners <p> <li> <li> <p> Is an excellent leader who enjoys facilitating the personal development of colleagues <p> <li> <li> <p> Selfstarter with great time management skills <p> <li> <li> <p> Strong attention to detail and highly organized <p> <li> <li> <p> Ability to execute in the short term while planning long term <p> <li> <li> <p> Ability to make difficult decisions for the good of the business <p> <li> <li> <p> Excellent written and verbal communication skills <p> <li> <li> <p> This is a remotebased position in the United States United Kingdom or Canada that may require some travel <p> <li> <ul> <p> <p> <p> <p> <p> <em> The annual base salary range for this role is $18500000 $20000000 USD The total compensation offered for this position may vary based on factors such as education experience skills and location It may also include noncash rewards and benefits The base salary range is subject to change and may be modified in the future <em> <p> <p> <p> <p> <em> The Athletic offers unique perks and benefits to all fulltime employees based on their country of residence Our comprehensive US benefits package includes <em> <p> <p> <p> <p> <em> Highly competitive employercontributed medical dental vision basic life and disability insurance plans <em> <p> <p> <em> Savings accounts for medical wellness and childcare expenses <em> <p> <p> <em> 401k retirement savings plan and employer match <em> <p> <p> <em> Paid time off including paid sick leave 12 paid holidays 15 days of accrued vacation to start and up to 20 weeks of Paid Parental Leave <em> <p> <p> <p> <p> <em> For international candidates Our global benefits packages offer similar benefits and perks competitive to the local market <em> <p> <p> <p> <p> <em> The Athletic Media Company is an equal opportunity employer and enthusiastically encourages people from all backgrounds and experiences to apply The Athletic will consider all applicants without regard to race religion color national origin ancestry physical andor mental disability medical condition genetic information marital status sex gender gender identity gender expression transgender status age sexual orientation military or veteran status or any other protected characteristic under applicable law <em> <p> <p> <p> <p> <em> Click here to review our <em> <a class=fontbold underline fontbold underline postingslink href=httpsprivacytheathleticcompoliciesname=globalprivacypolicywhatinformationdowegatheraboutyou rel=noopener noreferrer nofollow target=blank> <em> Applicant Privacy Notice <em> <a> <em> which describes how and when The Athletic Media Company collects uses and shares certain personal information of job applicants and prospective employees <em> <p> <p> <p> <p> <em> Beware of fraudulent job recruiting schemes Our recruiters use <em> <a class=fontbold underline fontbold underline postingslink href=mailtocareerstheathleticcom rel=noopener noreferrer nofollow target=blank> <em> careerstheathleticcom <em> <a> <em> exclusively We do not conduct interviews via text or instant message and we do not ask candidates to download software to purchase equipment through us or to provide sensitive personally identifiable information such as bank accounts or social security numbers If you have been contacted by someone claiming to be a recruiter with The Athletic but operating from a different email address about a job offer please report it as potential job fraud to the law enforcement and to <em> <a class=fontbold underline fontbold underline postingslink href=mailtopeopletheathleticcom rel=noopener noreferrer nofollow target=blank> <em> peopletheathleticcom <em> <a> <em> <em> <p><p>
Machine Learning Engineer (L3)
Company: Twilio
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <h3> <strong> See yourself at Twilio <strong> <h3> <p> Join the team as Twilios next Machine Learning Engineer L3 on the Data Services and Throughput team <p> <h3> <strong> Who we are amp why were hiring <strong> <h3> <p> Twilio powers realtime business communications and data solutions that help <a class=fontbold underline fontbold underline fontbold underline href=httpscustomerstwiliocom rel=noopener noreferrer nofollow target=blank> companies and developers worldwide <a> build better applications and customer experiences <p> <p> Although were headquartered in San Francisco we have presence throughout South America Europe Asia and Australia Were on a journey to becoming a global company that actively opposes racism and all forms of oppression and bias At Twilio we support <a class=fontbold underline fontbold underline fontbold underline href=httpswwwtwiliocomcompanydiversity rel=noopener noreferrer nofollow target=blank> diversity equity amp inclusion <a> wherever we do business <p> <h3> <strong> About the job <strong> <h3> <p> This position is needed to to drive the innovation and creation of cuttingedge products that serve the needs of developers builders and operators You will be a crucial bridge between Product and Design tasked with developing evaluating and maintaining scalable Machine Learning models within lowlatency for realtime applications Your collaboration and expertise will be fundamental in delivering robust solutions that power our users success You will be closely working with a crossfunctional team of engineers architects product UIUX and partners to develop ML and data driven algorithm aspects of customer facing products in Twilio Communication applications <p> <p> Twilio Communications is the leading software for sending messages programmatically The Data Services and Throughput organization builds AIenabled capabilities that separate Twilio from its competitors in messaging capabilities <p> <h3> <strong> Responsibilities <strong> <h3> <p> In this role youll <p> <ul> <li> <p> Build and maintain scalable high quality machine learning solutions in production <p> <li> <li> <p> Design and implement tools and procedures to evaluate performance and accuracy of models and data <p> <li> <li> <p> Work closely with software engineers build tools to enhance productivity and to ship and maintain ML models <p> <li> <li> <p> Demonstrate endtoend understanding of applications and why behind models amp systems and develop high quality MLbased software at scale <p> <li> <li> <p> Truly own the product you work on Be responsible for SLA on call incident resolution customer feedback and participate in blameless postmortems to make our products better <p> <li> <li> <p> Partner with product managers tech leads and stakeholders to analyze business problems clarify requirements and define the scope of the systems and leverage stateoftheart Statistics Machine Learning Deep Learning and Gen AI to address the business problems <p> <li> <li> <p> Drive high engineering standards on the team through code review automated testing and mentoring <p> <li> <li> <p> Collaborate and brainstorm product ideas with product managers designers and engineers <p> <li> <ul> <h3> <strong> Qualifications <strong> <h3> <p> Not all applicants will have skills that match a job description exactly Twilio values diverse experiences in other industries and we encourage everyone who meets the required qualifications to apply While having desired qualifications make for a strong candidate we encourage applicants with alternative experiences to also apply If your career is just starting or hasnt followed a traditional path dont let that stop you from considering Twilio We are always looking for people who will bring something new to the table <p> <p> <strong> Required <strong> <p> <ul> <li> <p> 4+ years of applied ML experience <p> <li> <li> <p> Strong background in the foundations of machine learning and building blocks of modern deep learning <p> <li> <li> <p> Proficiency in Python or Java and familiarity with design patterns <p> <li> <li> <p> Track record of building shipping and maintaining machine learning models in production <p> <li> <li> <p> Extensive experience in technologies such as PyTorch Tensorflow Scikitlearn Spacy NLTK application frameworks eg Flask <p> <li> <li> <p> Deep understanding of ML model implementation cycle eg feature engineering trainingserving AB test model selection etc algorithms eg xgboost time series models deep learning graph neural networks optimization and domains eg forecasting personalization and recommendation system NLP embedding representation <p> <li> <li> <p> Familiarity with MLOps concepts related and maintaining models in production such as testing versioning model registry retraining and monitoring <p> <li> <li> <p> Demonstrated ability to ramp up understand and operate effectively in new application business domains <p> <li> <li> <p> Good written and verbal communication skills You are confident in writing down and presenting your designs and decisions throughout the development lifecycle You are also comfortable providing and receiving feedback in an Agile environment <p> <li> <ul> <p> <strong> Desired <strong> <p> <ul> <li> <p> Experience in recommendation systems forecasting models NLP techniques embedding representation approaches and statistical models <p> <li> <li> <p> Experience with Retrieval Augmented Generation Large Language Models and prompt engineering <p> <li> <li> <p> Knowledge of Java and system design concepts <p> <li> <li> <p> Understanding of Experience with CICD pipelines and automated deployment processes <p> <li> <li> <p> Experience with either AWS Azure or Google Cloud and technologies such as Spark Kafka Kubeflow GPU <p> <li> <ul> <h3> <strong> Location <strong> <h3> <p> This role will be and based in the US but is not eligible to be hired in NY WA CT CA and PA <p> <h3> <strong> Travel <strong> <h3> <p> We prioritize connection and opportunities to build relationships with our customers and each other For this role you may be required to travel occasionally to participate in project or team inperson meetings <p> <h3> <strong> What We Offer <strong> <h3> <p> There are many benefits to working at Twilio including in addition to competitive pay things like generous timeoff ample parental and wellness leave healthcare a retirement savings program and much more Offerings vary by location <p> <h3> <strong> Twilio thinks big Do you <strong> <h3> <p> We like to solve problems take initiative pitch in when needed and are always up for trying new things Thats why we seek out colleagues who embody our values something we call <a class=fontbold underline fontbold underline fontbold underline href=httpswwwtwiliocomcompanyvalues rel=noopener noreferrer nofollow target=blank> Twilio Magic <a> Additionally we empower employees to build <a class=fontbold underline fontbold underline fontbold underline href=httpstwilioorgsupportandresourcesimpactfund rel=noopener noreferrer nofollow target=blank> positive change in their communities <a> by supporting their volunteering and donation efforts <p> <p> So if youre ready to unleash your full potential do your best work and be the best version of yourself apply now <p> <p> If this role isnt what youre looking for <a class=fontbold underline fontbold underline fontbold underline href=httpswwwtwiliocomcompanyjobsopenpositions rel=noopener noreferrer nofollow target=blank> please consider other open positions <a> <p> <p> <em> Please note this role is open to candidates outside of Colorado California New York and Washington The information below is provided for candidates hired in those locations only <em> <p> <p> The estimated pay ranges for this role are as follows <p> <ul> <li> <p> Based in Colorado $13500 $169000 <p> <li> <li> <p> This role may be eligible to participate in Twilios equity plan and corporate bonus plan All roles are eligible for the following benefits health care insurance 401k retirement account paid sick time paid personal time off paid parental leave <p> <li> <ul> <p> The successful candidates starting salary will be determined based on permissible nondiscriminatory factors such as skills experience and geographic location within the state <p> <p> <strong> Twilio is proud to be an equal opportunity employer <strong> Twilio is proud to be an Equal Employment Opportunity and Affirmative Action employer We do not discriminate based upon race religion color national origin sex including pregnancy childbirth reproductive health decisions or related medical conditions sexual orientation gender identity gender expression age status as a protected veteran status as an individual with a disability genetic information political views or activity or other applicable legally protected characteristics We also consider qualified applicants with criminal histories consistent with applicable federal state and local law Additionally Twilio participates in the EVerify program in certain locations as required by law <p> <p> Twilio is committed to providing reasonable accommodations for qualified individuals with disabilities and disabled veterans in our job application procedures If you need assistance or an accommodation due to a disability please contact us at accommodationtwiliocom <p><p>
Software Engineer - Seller Experience
Company: Whatnot
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <h2> <strong> 🚀 Whatnot <strong> <h2> <p> Whatnot is a livestream shopping platform and marketplace backed by Andreessen Horowitz Y Combinator and CapitalG Were building the future of ecommerce bringing together community shopping and entertainment We are committed to our <a class=fontbold underline fontbold underline fontbold underline href=httpswwwwhatnotcomcareers rel=noopener noreferrer nofollow target=blank> values <a> and as a remotefirst team we operate out of hubs within the US Canada UK Ireland and Germany today <p> <p> Were innovating in the fastpaced world of live auctions in categories including sports fashion video games and streetwear The platform couples rigorous seller vetting with a focus on community to create a welcoming space for buyers and sellers to share their passions with others <p> <p> And were growing Whatnot has been the <a class=fontbold underline fontbold underline fontbold underline href=httpsa16zcommarketplace100 rel=noopener noreferrer nofollow target=blank> fastest growing marketplace <a> in the US over the past two years and were hiring forwardthinking problem solvers across all functional areas <p> <h2> <strong> 💻 Role <strong> <h2> <p> The Seller Experience team plays a crucial role in empowering our community of sellers with tools and experiences that allow them to succeed and grow on Whatnot You will be at the forefront of developing scalable user friendly solutions that enhance the seller journey at every step of the lifecycle from onboarding scaling and growth The problems you will tackle span from Casual Resellers to Large Retailers <p> <h2> <strong> 👋 You <strong> <h2> <p> Curious about who thrives at Whatnot Weve found that low ego a growth mindset and leaning into action and high impact goes a long way here <p> <p> As our next Software Engineer you should have 5+ years of generalist software engineering experience at a fast growing technology company plus <p> <ul> <li> <p> We primarily use Python JavaScript Elixir and are open to others <p> <li> <li> <p> Excellent product instincts You first think about users rather than the best technical solution <p> <li> <li> <p> You are known for shipping products and features lightningfast <p> <li> <li> <p> Youre an excellent problem solver and dont need to be told exactly what to do <p> <li> <li> <p> Comfortable working across the stack backend and frontend <p> <li> <li> <p> Ability to pick up on new technologies very quickly <p> <li> <li> <p> Proven track record of delivering features <p> <li> <li> <p> Bonus Experience building technology in ecommerce contributing to seller experiences and success <p> <li> <ul> <h2> <strong> 💰Compensation <strong> <h2> <p> For USbased applicants <strong> <strong> $178000year to $235000year + benefits + stock options <p> <p> The salary range may be inclusive of several levels that would be applicable to the position Final salary will be based on a number of factors including level relevant prior experience skills and expertise This range is only inclusive of base salary not benefits more details below or equity in the form of stock options <p> <h2> <strong> 🎁 Benefits <strong> <h2> <ul> <li> <p> Flexible Time off Policy and Companywide Holidays including a spring and winter break <p> <li> <li> <p> Health Insurance options including Medical Dental Vision <p> <li> <li> <p> Work From Home Support <p> <ul> <li> <p> $1000 home office setup allowance <p> <li> <li> <p> $150 monthly allowance for cell phone and internet <p> <li> <ul> <li> <li> <p> Care benefits <p> <ul> <li> <p> $450 monthly allowance on food <p> <li> <li> <p> $500 monthly allowance for wellness <p> <li> <li> <p> $5000 annual allowance towards Childcare <p> <li> <li> <p> $20000 lifetime benefit for family planning such as adoption or fertility expenses <p> <li> <ul> <li> <li> <p> Retirement 401k offering for Traditional and Roth accounts in the US employer match up to 4 of base salary and Pension plans internationally <p> <li> <li> <p> Parental Leave <p> <ul> <li> <p> 16 weeks of paid parental leave + one month gradual return to work company leave allowances run concurrently with country leave requirements which take precedence <p> <li> <ul> <li> <ul> <h2> <strong> 💛 EOE <strong> <h2> <p> Whatnot is proud to be an Equal Opportunity Employer We value diversity and we do not discriminate on the basis of race religion color national origin gender sexual orientation age marital status veteran status parental status disability status or any other status protected by local law We believe that our work is better and our company culture is improved when we encourage support and respect the different skills and experiences represented within our workforce <p><p>
Senior Full Stack Engineer - Save
Company: Rocket Money
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> <strong> ABOUT ROCKET MONEY 🔮 <strong> <p> <p> Rocket Moneys mission is to empower people to live their best financial lives Rocket Money offers members a unique understanding of their finances and a suite of valuable services that save them time and money ultimately giving them a leg up on their financial journey <p> <p> <strong> ABOUT THE TEAM <strong> 🤝 <p> <p> Team Save is dedicated to empowering our users to save money by offering features like Smart Savings Bill Negotiations and Cancellations These features attract significant traffic due to the impact they have on our users ability to save and its rewarding to see the positive influence we have on real people <p> <p> <strong> IN THIS ROLE YOULL <strong> <p> <ul> <li> <p> Work alongside a team to implement iterate and debug product features that drive forward both the company and the user <p> <li> <li> <p> Own projects from end to end making key decisions in the implementation of new features that balance technical concerns with business concerns <p> <li> <li> <p> Develop with TypeScript across the stack building user interfaces using React Native and the backend support required to power them with Node amp GraphQL <p> <li> <li> <p> Be a steward of good user experience ensuring that the interfaces we present our users are performant understandable and delightful <p> <li> <li> <p> Help to maintain our high technical bar participating in code reviews and design discussions to ensure that were applying appropriate rigor to our software development process <p> <li> <li> <p> Develop an understanding of our users to build and measure features which help them better understand and improve their finances <p> <li> <ul> <p> <strong> ABOUT YOU <strong> 🦄 <p> <ul> <li> <p> You have 5+ years of professional experience working with some combination of NodeTypeScript React GraphQL and Postgres or similar relational database <p> <li> <li> <p> Youre both a student and a teacher continually seeking to grow as an engineer and help those around you grow as well <p> <li> <li> <p> Youre not just interested in what youre building but also why youre building it You want to see the bigger picture of how the software youre building is benefitting our users <p> <li> <li> <p> Experience with our stack TypeScript React Native PostgreSQL is a plus <p> <li> <li> <p> You understand observability and enjoy digging into the details to solve performance and user experience issues <p> <li> <li> <p> You thrive in a growing organization and are not afraid of a challenging problem In fact you confront problems head on and take the lead on the solution <p> <li> <ul> <p> <strong> WE OFFER 💫 <strong> <p> <ul> <li> <p> Health Dental amp Vision Plans <p> <li> <li> <p> Competitive Pay <p> <li> <li> <p> Matching 401k <p> <li> <li> <p> Unlimited PTO <p> <li> <li> <p> Lunch daily <p> <li> <li> <p> Snacks amp Coffee <p> <li> <li> <p> Commuter benefits <p> <li> <ul> <p> Additional Information Salary range of $150000 $185000year + bonus + benefits Base pay offered may vary depending on jobrelated knowledge skills and experience <p> <p> Rocket Money is an Affirmative Action and Equal Opportunity Employer All qualified applicants will receive consideration for employment without regard to race color religion sex sexual orientation gender identity national origin or protected veteran status and will not be discriminated against on the basis of disability <p> <p> Pursuant to the San Francisco Fair Chance Ordinance we will consider for employment qualified applicants with arrest and conviction records <p><p>
Senior Backend Engineer - Styles
Company: Webflow
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> At Webflow our mission is to bring development superpowers to everyone Webflow is the leading visual development platform for building powerful websites without writing code By combining modern web development technologies into one platform Webflow enables people to build websites visually saving engineering time while clean code seamlessly generates in the background From independent designers and creative agencies to Fortune 500 companies millions worldwide use Webflow to be more nimble creative and collaborative Its the web made better <p> <p> The Styles team is responsible for building and investing in the design capabilities of our core product to empower millions of designers worldwide to easily adopt Webflow to build manage and scale any number of sites efficiently <p> <p> Were looking for a Senior Backend Engineer to join the Styles team and lead the team to deliver impactful features for our customers to build highly personalized web experiences In this role you will execute the technical direction and be a mentor amp partner to other engineers on the team Additionally you will help lead crossfunctional efforts to drive even greater impact <p> <h2> <strong> About the role <strong> <h2> <ul> <li> <p> Location Remotefirst United States BC amp ON Canada <p> <li> <li> <p> Fulltime <p> <li> <li> <p> Permanent <p> <li> <li> <p> Exempt US Candidates <p> <li> <li> <p> Reporting to the Engineering Manager of Designer UX team <p> <li> <li> <p> The cash compensation for this role is tailored to align with the cost of labor in different geographic markets Weve structured the base pay ranges for this role into zones for our geographic markets and the specific base pay within the range will be determined by the candidates geographic location jobrelated experience knowledge qualifications and skills <p> <ul> <li> <p> Zone A $162500 $216050 <p> <li> <li> <p> Zone B $152700 $203100 <p> <li> <li> <p> Zone C $143000 $190150 <p> <li> <ul> <ul> <li> <p> CAD 184600 CAD 245500 <p> <li> <ul> <ul> <li> <p> United States all figures cited below in USD and pertain to workers in the United States <p> <li> <li> <p> Canada All figures cited below in CAD and pertain to workers in ON amp BC Canada <p> <li> <ul> <li> <ul> <p> Please visit our <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowaboutwebflowiocareers rel=noopener noreferrer nofollow target=blank> Careers page <a> for more information on which locations are included in each of our geographic pay zones However please confirm the zone for your specific location with your recruiter <p> <p> As a Senior Backend Engineer youll <p> <ul> <li> <p> Design and implement scalable backend services <p> <li> <li> <p> Drive crosspillar collaboration with software engineers product managers designers and QA analysts in an autonomous supportive team environment <p> <li> <li> <p> Effectively communicate team priorities and strategy to engineering and crossfunctional leadership teams <p> <li> <li> <p> Build and maintain unit and integration tests <p> <li> <li> <p> Provide clarity on processes and priorities to crosspillar partners and other engineers on the team <p> <li> <li> <p> Mentor other engineers on best practices code design considerations and quality <p> <li> <ul> <p> In addition to the responsibilities outlined above at Webflow we will support you in identifying where your interests and development opportunities lie and well help you incorporate them into your role <p> <h2> <strong> About you <strong> <h2> <p> Youll thrive as a Senior Backend Engineer Styles if you <p> <ul> <li> <p> Have 5+ years of experience in scalable multitenant environments <p> <li> <li> <p> Have 2+ years experience working with feature teams on customerfacing products shipping and iterating to solve customer problems <p> <li> <li> <p> Value testing and documentation equally as much as your code <p> <li> <li> <p> Are comfortable with ambiguity and scoping solutions with your teammates <p> <li> <li> <p> Are comfortable working on JavascriptTypescript MongoDB and Node <p> <li> <li> <p> Have consistently communicated trade offs throughout a project to meet both technical and business requirements <p> <li> <li> <p> Enjoy highvisibility work and presenting to executive counterparts <p> <li> <li> <p> Get excited about encouraging and developing other engineers <p> <li> <ul> <p> Even if you dont meet 100 of the above qualifications you should still seriously consider applying Research shows that you may still be considered for a role if you meet just half of the requirements <p> <p> <strong> Our Core Behaviors <strong> <p> <ul> <li> <p> <strong> Obsess over customer experience <strong> We deeply understand what were building and who were building for and serving We define the leading edge of whats possible in our industry and deliver the future for our customers <p> <li> <li> <p> <strong> Move with heartfelt urgency <strong> We have a healthy relationship with impatience channeling it thoughtfully to show up better and faster for our customers and for each other Time is the most limited thing we have and we make the most of every moment <p> <li> <li> <p> <strong> Say the hard thing with care <strong> Our best work often comes from intelligent debate critique and even difficult conversations We speak our minds and dont sugarcoat things and we do so with respect maturity and care <p> <li> <li> <p> <strong> Make your mark <strong> We seek out new and unique ways to create meaningful impact and we champion the same from our colleagues We work as a team to get the job done and we go out of our way to celebrate and reward those going above and beyond for our customers and our teammates <p> <li> <ul> <h3> <strong> Benefits amp wellness <strong> <h3> <ul> <li> <p> Equity ownership RSUs in a growing privatelyowned company <p> <li> <li> <p> 100 employerpaid healthcare vision and dental insurance coverage for employees and dependents fulltime employees working 30+ hours per week as well as Health Savings AccountHealth Reimbursement Account dependent care Flexible Spending Account US only dependent on insurance plan selection where applicable in the respective country of employment Employees may also have voluntary insurance options such as life disability hospital protection accident and critical illness where applicable in the respective country of employment <p> <li> <li> <p> 12 weeks of paid parental leave for both birthing and nonbirthing caregivers as well as an additional 68 weeks of pregnancy disability for birthing parents to be used before child bonding leave where local requirements are more generous employees receive the greater benefit Employees also have access to family planning care and reimbursement <p> <li> <li> <p> Flexible PTO with a mandatory annual minimum of 10 days paid time off for all locations where local requirements are more generous employees receive the greater benefit and sabbatical program <p> <li> <li> <p> Access to mental wellness and professional coaching therapy and Employee Assistance Program <p> <li> <li> <p> Monthly stipends to support health and wellness smart work and professional growth <p> <li> <li> <p> Professional career coaching internal learning amp development programs <p> <li> <li> <p> 401k plan and pension schemes in countries where statutorily required financial wellness benefits like CPA or financial advisor coverage <p> <li> <li> <p> Discounted Pet Insurance offering US only <p> <li> <li> <p> Commuter benefits for inoffice employees <p> <li> <ul> <p> <em> Temporary employees are not eligible for paid holiday time off accrued paid time off paid leaves of absence or companysponsored perks unless otherwise required by law <em> <p> <h3> <strong> Be you with us <strong> <h3> <p> At Webflow equality is a core tenet of our culture We are an Equal Opportunity EEOVeteransDisabled Employer and are <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomdiversityequityinclusion rel=noopener noreferrer nofollow target=blank> committed <a> to building an inclusive global team that represents a variety of backgrounds perspectives beliefs and experiences Employment decisions are made on the basis of jobrelated criteria without regard to race color religion sex sexual orientation gender identity national origin disability veteran status or any other classification protected by applicable law Pursuant to the San Francisco Fair Chance Ordinance Webflow will consider for employment qualified applicants with arrest and conviction records <p> <h3> <strong> Stay connected <strong> <h3> <p> Not ready to apply but want to be part of the Webflow community Consider following our story on our <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomblog rel=noopener noreferrer nofollow target=blank> Webflow Blog <a> <a class=fontbold underline fontbold underline fontbold underline href=httpswwwlinkedincomcompanywebflowinc rel=noopener noreferrer nofollow target=blank> LinkedIn <a> <a class=fontbold underline fontbold underline fontbold underline href=httpstwittercomwebflow rel=noopener noreferrer nofollow target=blank> X Twitter <a> andor <a class=fontbold underline fontbold underline fontbold underline href=httpswwwglassdoorcomReviewsWebflowReviewsE890506htm rel=noopener noreferrer nofollow target=blank> Glassdoor <a> <p> <h3> <strong> Please note <strong> <h3> <p> <em> We will ensure that individuals with disabilities are provided reasonable accommodation to participate in the job application or interview process to perform essential job functions and to receive other benefits and privileges of employment Upon interview scheduling instructions for confidential accommodation requests will be administered <em> <p> <p> <em> To join Webflow youll need a valid right to work authorization depending on the country of employment <em> <p> <p> <em> If you are extended an offer that offer may be contingent upon your successful completion of a background check which will be conducted in accordance with applicable laws We may obtain one or more background screening reports about you solely for employment purposes <em> <p> <p> <em> For information about how Webflow processes your personal information please review <em> <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomlegalapplicantprivacynotice rel=noopener noreferrer nofollow target=blank> <em> Webflows Applicant Privacy Notice <em> <a> <em> <em> <p><p>
Payor Success & Relations Partnerships Manager
Company: Grow Therapy
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> <strong> What Youll Be Doing <strong> <p> <p> Were looking for an experienced Partnerships Manager for our Insurance Operations team who is passionate about improving the landscape for mental healthcare You will lead our strategic partnerships with insurance companies within our Payor Success and Relations department You will be responsible for developing and strengthening relationships with new and existing partners as well as executing on new and existing engagement opportunities You will also play an essential role as liaison in ensuring that our credentialing data analytics and revenue cycle management teams have the appropriate infrastructure in place to grow our provider base get our providers innetwork with insurance companies and obtain reimbursement for services to enable continued engagement and growth Youll thrive in this role if you are a master communicator and endlessly curious with a love for crossfunctional learning and collaboration as well as datainformed storytelling As you get to know our internal systems and processes better youll have the opportunity to expand your impact into different areas of the business and youll eventually become the goto person for a myriad of responsibilities pertaining to our partners unique needs <p> <ul> <li> <p> Lead key partnership implementation workstreams including new partnership development expansion of existing partnerships and collaboration with internal and external crossfunctional partners Internal teams include Growth Customer amp Client Support Tech and other Insurance Operations teams <p> <li> <li> <p> Lead implementation of new opportunities for partnerships at Grow and act as the subject matter expert on partner KPIs <p> <li> <li> <p> Develop creative strategies to deepen our existing relationships with partners that are of high value to our organization and mission <p> <li> <ul> <p> <em> Salary range $116000 $140000 <em> <p> <p> <strong> Youll Be a Good Fit If <strong> <p> <ul> <li> <p> Empathetic Leader You have a strong track record of building high performing teams cross functionally Can intuit the needs of external partners before theyre even shared Ability to performance manage individual team members when necessary <p> <li> <li> <p> Detail Oriented Youre a meticulous reviewer of your own and others work <p> <li> <li> <p> Problem Solver Youre able to identify business challenges based on metrics and analyses and youre ready to recommend solutions to improve business processes <p> <li> <li> <p> MissionDriven Youre here to change the world and youre always connecting your work back to the importance of the Grow Therapy mission <p> <li> <li> <p> Agile You thrive in a fastpaced unpredictable environment and youre able to pivot as new priorities emerge <p> <li> <li> <p> Team Player Youre collaborative by nature relish in camaraderie and group wins and are looked to by your colleagues as a steadfast partner and source of encouragement <p> <li> <li> <p> Passionate Storyteller Youre good at transforming dashboards and other data insights into a compelling story for our external partners taking into account macro goals of our organization plus those of our partners <p> <li> <li> <p> Master of Project Management Youre a master at juggling multiple initiatives and clear ability to prioritize the most important stuff Highly organized and able to keep projects and priorities on track <p> <li> <ul> <p> <em> If you dont meet every single requirement but are still interested in the job please apply Nobody checks every box and Grow believes the perfect candidate is more than just a resume <em> <p> <p> Note Please upload your resume in PDF format <p><p>
Principal Software Engineer
Company: RapidAI
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> RapidAI is the global leader in using AI to combat lifethreatening vascular and neurovascular conditions RapidAI is empowering physicians to make faster decisions for better patient outcomes leading the next evolution of clinical decisionmaking and patient workflow Based on intelligence gained from over 10 million scans in more than 2000 hospitals in over 60 countries the Rapid® platform transforms care coordination offering care teams a level of patient visibility never before possible RapidAI where AI meets patient care <p> <p> <p> <p> <p> <p> <strong> What you will do <strong> <p> <ul> <li> <p> Design complex scalable software systems and architectures Evaluate existing architectures and propose improvements Ensure technical decisions align with product roadmap <p> <li> <li> <p> Plan technical projects and milestone deliverables in alignment with product managers Coordinate engineers and their tasks and monitor overall progress <p> <li> <li> <p> Design and build impactful technical solutions and own them through the entire development lifecycle <p> <li> <li> <p> Develop complex features and components Review code and designs developed by other engineers Debug difficult issues across the codebase <p> <li> <li> <p> Research the latest technologies and propose ways to integrate them to improve the product Come up with solutions for technical challenges and improvements <p> <li> <li> <p> Provide technical guidance and mentorship to other engineers Establish engineering best practices and standards <p> <li> <li> <p> Clearly communicate complex technical concepts and designs to both technical and nontechnical audiences Collaborate cross functionally across product program management and other teams <p> <li> <li> <p> Establish quality standards design review checklists code review processes etc Monitor system performance and ensure quality goals are met Drive continuous improvement <p> <li> <ul> <p> <p> <p> <strong> What you bring <strong> <p> <ul> <li> <p> Bachelors Degree or equivalent <p> <li> <li> <p> 12+ years of experience in software development and demonstrated engineering leadership <p> <li> <li> <p> 8+ years of experience in backend development <p> <li> <li> <p> 3+ years in using Typescript and Amazon AWS <p> <li> <li> <p> High level of skill in at least one generalpurpose backend language and one frontend language but willingness to work with other languages if required <p> <li> <li> <p> High level of distributed system design skill <p> <li> <li> <p> Creating platforms reusable libraries and utilities wherever applicable <p> <li> <li> <p> Writing highquality code that is modular functional and testable <p> <li> <li> <p> Troubleshoot issues effectively in a distributed architecture <p> <li> <li> <p> Communicate collaborate and work effectively in a global environment <p> <li> <li> <p> Solid analytical and reasoning skills for design troubleshooting and root cause analysis <p> <li> <li> <p> Great communication skills with technical and nontechnical teams <p> <li> <ul> <p> <p> <p> <strong> Bonus Skills <strong> <p> <ul> <li> <p> iOS or Android development experience Swift Kotlin and good understanding of Native mobile <p> <li> <li> <p> Experience in a regulated software environment eg medical device aerospace defense automotive <p> <li> <li> <p> Experience with DICOM HL7 or other medical data formatsprotocols <p> <li> <ul> <p> <p> <p> <strong> What we offer you <strong> <p> <ul> <li> <p> RapidAI pays 100 for employee coverage amp 75 for your dependent coverage for medical dental amp vision premiums <p> <li> <li> <p> Medical Benefits We offer a range of policies through TriNet <p> <li> <li> <p> Life InsuranceADampD is 1X times your annual salary <p> <li> <li> <p> We pay 100 for Short and Long Term Disability <p> <li> <li> <p> Healthcare and Dependent care flexible spending accounts are available <p> <li> <li> <p> A 401k plan is offered through Empower <p> <li> <li> <p> RapidAI provides $100 a month for internetcellphone services <p> <li> <ul> <p> Time Off <p> <ul> <li> <p> We have 10 company paid holidays <p> <li> <li> <p> RapidAI has a flexible vacation policy We urge employees to take vacation Vacation allows employees to renew reinvigorate and rejuvenate <p> <li> <ul> <p> Other Cool Benefits <p> <ul> <li> <p> Equity Stock Options <p> <li> <li> <p> Incentive Compensation <p> <li> <li> <p> And most importantly You are joining an awesome team <p> <li> <ul> <p> <p> <p> <p> <p> <strong> Compensation <strong> The salary range target for the role described in this job description is $200000 to $208000 Final offer amounts depend on multiple factors including but not limited to candidate experience and expertise geographic location compensationequity mix and market data This position may also be eligible for additional incentives such as equity awards shortterm incentives or sales compensation <p> <p> <p> <p> RapidAI is committed to creating an inclusive and diverse workplace We provide equal employment opportunities to all employees and applicants and prohibit discrimination and harassment of any type in regard to race color religion age sex national origin disability status genetics protected veteran status sexual orientation gender identity or expression or any other characteristic protected by federal state or local laws <p> <p> <p> <p> Please review our CPRA policies <a class=fontbold underline fontbold underline postingslink href=httpsrapidaiboxcomsbc5l0izmwcyf8mu34sbsalmzx4ly1mkl rel=noopener noreferrer nofollow target=blank> here <a> <p> <p> For more information on the information we collect about our applicants and how we use it see our CPRA Privacy Notice <a class=fontbold underline fontbold underline postingslink href=httpsrapidaiboxcomslpyfu84mmopywvcox0i4ej15c4v84ck1 rel=noopener noreferrer nofollow target=blank> here <a> <p><p>
Account Executive (Manager/Director of Strategic Accounts)
Company: OfferFit
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> <strong> Position Overview <strong> <p> <p> Were currently looking for a driven Account Executive ManagerDirector of Strategic Accounts to join our team In this role youll be responsible for winning and growing business for OfferFit by owning new and existing senior customer relationships <p> <p> <strong> In particular you will <strong> <p> <ul> <li> <p> Working closely with our business development amp marketing teams to create leads <p> <li> <li> <p> Lead discussions with potential new OfferFit customers <p> <li> <li> <p> Work with current and future OfferFit customers to determine the highestimpact applications of our AIsolution <p> <li> <li> <p> Participate in OfferFit POV motion to ensure they progress successfully working closely with OfferFits technical Implementation team <p> <li> <li> <p> Build amp own relationships with senior leaders at OfferFits customer companies eg CMOs CIOs <p> <li> <li> <p> Communicate customer needs to OfferFits product amp marketing teams ensuring a customercentric product roadmap <p> <li> <ul> <p> <strong> Why is it great <strong> <p> <ul> <li> <p> Be the face of the company working alongside our customers to help them succeed <p> <li> <li> <p> Sell a product with strong productmarket fit the pain of manual experimentation is a real pain point for marketers leading to a high level of enthusiasm for our products <p> <li> <li> <p> Get strong support from leadership OfferFit prioritizes sales helping your team succeed will be a true priority for the CEO and other Sales leadership team members <p> <li> <li> <p> Lead the AI transformation happening in marketing technology today OfferFit is at the forefront so youll be in the middle of the action <p> <li> <li> <p> Join OfferFits fastpaced supportive and professional team We make sure all of our team members are empowered and receive great mentorship and coaching <p> <li> <ul> <p> <strong> Whos a fit <strong> <p> <ul> <li> <p> Executionfocused leader you can structure a plan align stakeholders and see it through to execution <p> <li> <li> <p> People person you build trustbased relationships with internal team members and external partners and combine empathy with a willingness to have direct challenging conversations <p> <li> <li> <p> Processdriven you can create scalable frameworks to optimize the success of business outcomes <p> <li> <li> <p> Entrepreneurial you take initiative work around obstacles and always seek creative ways to get to the next level <p> <li> <li> <p> Technology enthusiast you are passionate about new technologies and their potential to impact businessasusual <p> <li> <li> <p> Clear communicator you are able to express yourself clearly and persuasively both in writing and speech <p> <li> <li> <p> Sales expert you have a history of enterprise sales and are wellversed in SPIN selling amp MEDDPICC qualification methodology <p> <li> <ul> <p> The base salary range for this position in the United States is $81000$142000 per year plus eligibility for additional commissionbonus ranging $91000$162000 with an overall OTE of $172000$305000 ability to earn more based on sales goals Eligibility for an additional end of year performance bonus commissions when applicable andor equity options may be provided as part of the compensation package in addition to a full range of medical financial andor other benefits depending on the position offered For nonUS based candidates base pay and overall compensation packages will be adjusted based on location Applicants should apply via OfferFits internal or external careers site <p> <p> <strong> OfferFit Benefits and Perks <strong> <p> <ul> <li> <p> Generous PTO starting at 25 days PTO per year and Parental leave policy 12 weeks paid <p> <li> <li> <p> 100 remote work environment with flexible hours <p> <li> <li> <p> Quarterly gatherings where we meet in person in a different city to work together bond as a team and celebrate our progress <p> <li> <li> <p> Weekly team events lunch and learns trivia virtual escape rooms town hall and team health barometer meetings <p> <li> <li> <p> Ability to learn and develop from an experienced leadership team exAmazon McKinsey BCG and IBM among others who are focused on building a talented diverse and inclusive tea <p> <li> <li> <p> Dedication to building a strong culture eg team resource groups weekly recognitions major life event celebrations mental healthsustainability days off etc <p> <li> <li> <p> US Only Competitive benefits major medical vision dental and LTD and 401K matching program <p> <li> <ul><p>