Public Notice Flyer Jobs in USA

193,662 open positions · Updated daily

Looking for Public Notice Flyer jobs in USA? Browse our curated listings with transparent salary information to find the perfect Public Notice Flyer position in the USA area.

Senior Backend Engineer - Shared Services

Company: Webflow

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <p> At Webflow our mission is to bring development superpowers to everyone Webflow is the leading visual development platform for building powerful websites without writing code By combining modern web development technologies into one platform Webflow enables people to build websites visually saving engineering time while clean code seamlessly generates in the background From independent designers and creative agencies to Fortune 500 companies millions worldwide use Webflow to be more nimble creative and collaborative Its the web made better <p> <p> We are looking for a Senior Backend Engineer to join the Shared Services team to enable our engineering team to build more efficiently so we can further our mission of bringing visual development superpowers to everyone If youre passionate about engineering excellence and driving operational efficiency wed love to hear from you <p> <h2> <strong> About the role <strong> <h2> <ul> <li> <p> Location Remotefirst United States BC amp ON Canada <p> <li> <li> <p> Fulltime <p> <li> <li> <p> Permanent <p> <li> <li> <p> Exempt <p> <li> <li> <p> The cash compensation for this role is tailored to align with the cost of labor in different geographic markets Weve structured the base pay ranges for this role into zones for our geographic markets and the specific base pay within the range will be determined by the candidates geographic location jobrelated experience knowledge qualifications and skills <p> <ul> <li> <p> United States all figures cited below in USD and pertain to workers in the United States <p> <ul> <li> <p> Zone A $162500 $216050 <p> <li> <li> <p> Zone B $152700 $203100 <p> <li> <li> <p> Zone C $14300 $190150 <p> <li> <ul> <li> <li> <p> Canada All figures cited below in CAD and pertain to workers in ON amp BC Canada <p> <ul> <li> <p> CAD 184600 CAD 245500 <p> <li> <ul> <li> <ul> <li> <li> <p> Please visit our <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowaboutwebflowiocareers rel=noopener noreferrer nofollow target=blank> Careers page <a> for more information on which locations are included in each of our geographic pay zones However please confirm the zone for your specific location with your recruiter <p> <li> <li> <p> Reporting to the engineering manager <p> <li> <ul> <p> As Senior Backend Engineer youll <p> <ul> <li> <p> Develop a comprehensive knowledge of how areas of business such as architecture and infrastructure integrate to improve developer productivity and accomplish our business goals <p> <li> <li> <p> Collaborate with software engineers product managers designers and QA analysts in an autonomous supportive team environment <p> <li> <li> <p> Build and maintain shared services including but not limited to Inapp Email Notification platform and Feature Flag framework <p> <li> <li> <p> Identify develop and document APIs for Webflows service catalog as well as provide quick start guides for developer best practices <p> <li> <li> <p> Solve problems in a highly technical platform that empowers hundreds of engineers <p> <li> <li> <p> Improve our planning development and deployment processes to help you and your fellow team members <p> <li> <li> <p> Mentor coach and inspire a team of engineers of various levels <p> <li> <ul> <p> In addition to the responsibilities outlined above at Webflow we will support you in identifying where your interests and development opportunities lie and well help you incorporate them into your role <p> <h2> <strong> About you <strong> <h2> <p> Youll thrive in this role if you <p> <ul> <li> <p> Have 5+ years developing and deploying web applications with a proven track record of shipping to market <p> <li> <li> <p> Excellent organization and communication skills both verbal and written <p> <li> <li> <p> Have worked on complex issues where the analysis requires an indepth knowledge of the company and existing architecture <p> <li> <li> <p> Can debug production issues across services and multiple levels of the stack <p> <li> <li> <p> Take pride in taking ownership and driving projects to business impact <p> <li> <li> <p> Proven experience building complex web systems <p> <li> <li> <p> Are familiar with one or more Javascript type systems we use TypeScript here <p> <li> <li> <p> Are comfortable working in an agile safetofail environment <p> <li> <ul> <p> <strong> Our Core Behaviors <strong> <p> <ul> <li> <p> <strong> Obsess over customer experience <strong> We deeply understand <em> what <em> were building and <em> who <em> were building for and serving We define the leading edge of whats possible in our industry and deliver the future for our customers <p> <li> <li> <p> <strong> Move with heartfelt urgency <strong> We have a healthy relationship with impatience channeling it thoughtfully to show up better and faster for our customers and for each other Time is the most limited thing we have and we make the most of every moment <p> <li> <li> <p> <strong> Say the hard thing with care <strong> Our best work often comes from intelligent debate critique and even difficult conversations We speak our minds and dont sugarcoat things and we do so with respect maturity and care <p> <li> <li> <p> <strong> Make your mark <strong> We seek out new and unique ways to create meaningful impact and we champion the same from our colleagues We work as a <em> team <em> to get the job done and we go out of our way to celebrate and reward those going above and beyond for our customers and our teammates <p> <li> <ul> <h3> <strong> Benefits amp wellness <strong> <h3> <ul> <li> <p> Equity ownership RSUs in a growing privatelyowned company <p> <li> <li> <p> 100 employerpaid healthcare vision and dental insurance coverage for employees and dependents fulltime employees working 30+ hours per week as well as Health Savings AccountHealth Reimbursement Account dependent care Flexible Spending Account US only dependent on insurance plan selection where applicable in the respective country of employment Employees may also have voluntary insurance options such as life disability hospital protection accident and critical illness where applicable in the respective country of employment <p> <li> <li> <p> 12 weeks of paid parental leave for both birthing and nonbirthing caregivers as well as an additional 68 weeks of pregnancy disability for birthing parents to be used before child bonding leave where local requirements are more generous employees receive the greater benefit Employees also have access to family planning care and reimbursement <p> <li> <li> <p> Flexible PTO with a mandatory annual minimum of 10 days paid time off for all locations where local requirements are more generous employees receive the greater benefit and sabbatical program <p> <li> <li> <p> Access to mental wellness and professional coaching therapy and Employee Assistance Program <p> <li> <li> <p> Monthly stipends to support health and wellness smart work and professional growth <p> <li> <li> <p> Professional career coaching internal learning amp development programs <p> <li> <li> <p> 401k plan and pension schemes in countries where statutorily required financial wellness benefits like CPA or financial advisor coverage <p> <li> <li> <p> Discounted Pet Insurance offering US only <p> <li> <li> <p> Commuter benefits for inoffice employees <p> <li> <ul> <h3> <strong> Be you with us <strong> <h3> <p> At Webflow equality is a core tenet of our culture We are an Equal Opportunity EEOVeteransDisabled Employer and are <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomdiversityequityinclusion rel=noopener noreferrer nofollow target=blank> committed <a> to building an inclusive global team that represents a variety of backgrounds perspectives beliefs and experiences Employment decisions are made on the basis of jobrelated criteria without regard to race color religion sex sexual orientation gender identity national origin disability veteran status or any other classification protected by applicable law Pursuant to the San Francisco Fair Chance Ordinance Webflow will consider for employment qualified applicants with arrest and conviction records <p> <h3> <strong> Stay connected <strong> <h3> <p> Not ready to apply but want to be part of the Webflow community Consider following our story on our <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomblog rel=noopener noreferrer nofollow target=blank> Webflow Blog <a> <a class=fontbold underline fontbold underline fontbold underline href=httpswwwlinkedincomcompanywebflowinc rel=noopener noreferrer nofollow target=blank> LinkedIn <a> <a class=fontbold underline fontbold underline fontbold underline href=httpstwittercomwebflow rel=noopener noreferrer nofollow target=blank> X Twitter <a> andor <a class=fontbold underline fontbold underline fontbold underline href=httpswwwglassdoorcomReviewsWebflowReviewsE890506htm rel=noopener noreferrer nofollow target=blank> Glassdoor <a> <p> <h3> <strong> Please note <strong> <h3> <p> <em> To join Webflow youll need valid US or Canadian work authorization depending on the country of employment <em> <p> <p> <em> If you are extended an offer that offer may be contingent upon your successful completion of a background check which will be conducted in accordance with applicable laws We may obtain one or more background screening reports about you solely for employment purposes <em> <p> <p> <em> For information about how Webflow processes your personal information please review <em> <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomlegalapplicantprivacynotice rel=noopener noreferrer nofollow target=blank> <em> Webflows Applicant Privacy Notice <em> <a> <em> <em> <p> <p> <p><p>

Director - Corporate FP&A

Company: Icertis

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <p> With unmatched technology and categorydefining innovation Icertis pushes the boundaries of whats possible with contract lifecycle management CLM The AIpowered analystvalidated Icertis Contract Intelligence ICI platform turns contracts from static documents into strategic advantage by structuring and connecting the critical contract information that defines how an organization runs Today the worlds most iconic brands and disruptive innovators trust Icertis to fully realize the intent of their combined 10 million contracts worth more than $1 trillion in 40+ languages and 93 countries <p> <p> <p> <p> <strong> Who we are <strong> Icertis is the only contract intelligence platform companies trust to keep them out in front now and in the future Our unwavering commitment to contract intelligence is grounded in our FORTE valuesFairness Openness Respect Teamwork and Executionwhich guide all our interactions with employees customers partners and stakeholders Because in our mission to be the contract intelligence platform of the world we believe how we get there is as important as the destination <p> <p> <p> <p> As the Director of FPampA you will play a critical leadership role you will work closely with all of companys functional leaders and bring key market strategic and operational insights that will shape the direction of the company and accelerate its growth You will also play a key role in telling the companys financial story to investors <p> <p> <p> <p> The ideal candidate will have a proven trackrecord of driving business outcomes through keen financial insight and business modeling They will have the ability to create a 360degree financial picture of the business that reflects and influences the companys strategy and be excellent at communicating with senior leaders and executives They will be toolsavvy with experience in creating scalable data and reporting solutions that support a datadriven culture LIRS1 <p> <p> <p> <p> <p> <p> <strong> What you will do <strong> <p> <ul> <li> <p> Formulate a robust 360degree financial picture of the business complete with market insights and operational drivers <p> <li> <li> <p> Develop and maintain the 3year Strategic Planning Model and forecast <p> <li> <li> <p> Deliver Global PampL and cash flow forecasts <p> <li> <li> <p> Drive Annual Planning Process work cross functionally to build and maintain the Annual Financial Plan and Departmental Budgets <p> <li> <li> <p> Build and deliver Business Performance ReportingOperating dashboards <p> <li> <li> <p> Perform strategic business analysis as needed MampA Geo Expansion <p> <li> <li> <p> Prepare financial analyses as needed to help drive improvements in the business Current focus areas include market expansion opportunities competitive benchmarking analyses pricing and strategic financial optimization strategies <p> <li> <li> <p> Partner with Controller to enhance and accelerate the financial reporting process <p> <li> <li> <p> Identifies and implements system and process improvements to increase the efficiency and effectiveness of planning and reporting workflows <p> <li> <li> <p> Prepare communications to Board of Directors <p> <li> <li> <p> Drive investor presentations and supporting analysis <p> <li> <li> <p> Develop a deep understanding of the business metrics with an eye towards understanding the benefits and risks from a financial perspective and helping to manage key business drivers and desired outcomes <p> <li> <li> <p> Play a key role in preparation of critical public financial documents to support the IPO process including working with bankers and supporting the production of investor materials and SEC filings eg S1 <p> <li> <ul> <p> <p> <p> <strong> What you will bring <strong> <p> <ul> <li> <p> 12+ years of experience of working in direct strategic analysis support of all aspects of the business at all areas of the PampL <p> <li> <li> <p> MBACPA or equivalent experience preferred <p> <li> <li> <p> Demonstrated complex modeling experience this is a handson role and managers are expected to directly contribute and lead by example <p> <li> <li> <p> Highly analytical detailoriented with a commitment to creating a highquality product Naturally inquisitive and able to extract information from various sources to identify and understand the underlying issue Not afraid to question results <p> <li> <li> <p> Prior success working in a fastpaced entrepreneurial environment takes initiative and works independently <p> <li> <li> <p> Working knowledge of accounting principles required including revenue recognition amortization and accrual vs cash accounting Must have a general understanding of financial statements <p> <li> <li> <p> Must have exceptional written visual and spoken communication skills <p> <li> <li> <p> Experience in preparing and delivering executive board and investor level communications <p> <li> <li> <p> IPO experience is a plus <p> <li> <li> <p> Must have advanced Excel Netsuite and Powerpoint skills <p> <li> <li> <p> Experience implementing financial analysis and planning tools required <p> <li> <ul> <p> <p> <p> <p> <p> $146000 $219000 a year <p> <p> <em> Pay offered will vary based on jobrelated factors such as location experience training skills and abilities In addition to the base salary and annual bonus target and an equity component is included in the compensation package <em> <p> <p> <strong> What we offer <strong> <p> <p> We are committed to the health and wellbeing of all Icertians their families the communities they live in and our customers This commitment is represented in the Icertis Four Rings of Responsibility Take Care of Self Take Care of Family Take Care of Community and Take Care of Business in that order <p> <p> <p> <p> To support these commitments Icertis offers excellent health and welfare benefits a generous 401k match and a robust paid time off program Here are some of the other reasons <a class=fontbold underline fontbold underline postingslink href=httpswwwicertiscomcompanynewsicertisplacesfirstinwashingtons100bestcompaniestoworkfor rel=noopener noreferrer nofollow target=blank> Icertis Places First in Washingtons 100 Best Companies to Work For | Icertis <a> <p> <p> <p> <p> ● Equity RSUs and shared ownership in the company <p> <p> ● Flexible work environment <p> <p> ● Paid maternity and paternity leave <p> <p> ● 7 Days for Humanity 7 paid volunteer days <p> <p> ● Generous holidays including the 4th of July week off paid <p> <p> ● Free professional and leadership coaching <p> <p> ● Annual personal development allowance <p> <p> <p> <p> Icertis Inc provides Equal Employment Opportunity to all employees and applicants for employment without regard to race color religion gender identity or expression sex sexual orientation national origin age disability genetic information marital status amnesty or status as a covered veteran in accordance with applicable federal state and local laws Icertis Inc complies with applicable state and local laws governing nondiscrimination in employment in every location in which the company has facilities If you are in need of accommodation or special assistance to navigate our website or to complete your application please send an email with your request to <a class=fontbold underline fontbold underline postingslink href=mailtocareersicertiscom rel=noopener noreferrer nofollow target=blank> careersicertiscom <a> or get in touch with your recruiter <p> <p> <p> <p> By submitting your application you acknowledge that you have read Icertiss Privacy Policy <a class=fontbold underline fontbold underline postingslink href=httpswwwicertiscomprivacystatement rel=noopener noreferrer nofollow target=blank> httpswwwicertiscomprivacystatement <a> <p> <p> <p> <p> Icertis is not open to third party solicitation or resumes for our posted FTE positions Resumes received from third party agencies that are unsolicited will be considered complimentary <p><p>

Head of Global Audio

Company: The Athletic Media Company

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <p> <strong> About Us <strong> <p> <p> <p> <p> The Athletic is a digital sports media company that brings true sports fans closer to the athletes teams and leagues that captivate their attention We serve a multifaceted audience that craves a richer connection and understanding with immersive storytelling and a likeminded community of fans Founded in 2016 and with major operational hubs in San Francisco Los Angeles London and Melbourne we empower a truly global team of more than 600 creators and cover more than 250 professional sports and collegiate teams across the United States Canada and the UK Our newsroom has produced thousands of indepth reports along with more than 120 podcasts and other forms of premium content Put simply The Athletic is at the center of a sports fans universe <p> <p> <p> <p> <p> <p> <strong> About the Role <strong> <p> <p> <p> <p> The Athletic has one of the worlds leading sports podcast networks and we are looking for an industry leader and creative visionary to push our podcasts into its next successful phase The Head of Global Audio will have creative accountability for all The Athletic podcasts in addition to leading the North American and International teams This leader will be tasked with developing the highest quality audio shows that fit The Athletics journalistic sensibility and also can reach large and engaged audiences both evolving existing shows and new Central to this creative success will be the leadership of our audio teams globally pushing their creative capabilities and creating a culture in which their teams can thrive <p> <p> <p> <p> <p> <p> <strong> Responsibilities <strong> <p> <ul> <li> <p> Manage the production and growth teams with regular check in and manage the staff of the entire audio department <p> <li> <li> <p> Partner with leadership to set ambitious goals and manage the team effectively toward those goals with wide latitude in how goals are accomplished <p> <li> <li> <p> Understand where tradeoffs need to happen across shows and be proactive with solutions <p> <li> <li> <p> Build podcasts with a diverse set of hosts and guests <p> <li> <li> <p> Curate formats shows and hosts that will offer subscribers a distinctive high quality and entertaining experience that helps drive commercial revenue <p> <li> <li> <p> Think about properties as franchises and come up with new ways to build audiencepromote network growth <p> <li> <li> <p> Partner with vertical leads across the newsroom to align with and complement our editorial strategy <p> <li> <li> <p> Work with the Managing Editor of video to develop a video strategy around our audio properties that serves as both a complement to audio and a new platform to build original Athletic content <p> <li> <li> <p> Work closely with the commercial team to monetize content and create strong long lasting brand partnerships <p> <li> <li> <p> Serve as the connective tissue between audio production and the heads of all other departments within the company to ensure that the audio teams output is appropriately supported promoted and monetized <p> <li> <li> <p> Develop meaningful relationships with leaders throughout HQ <p> <li> <li> <p> Provide input into the organization of the production team to ensure the team is set up to achieve its ambitious growth targets while staying within budget <p> <li> <ul> <p> <p> <p> <strong> Requirements <strong> <p> <ul> <li> <p> 10+ years of experience producing a national broadcast in an audio or video format <p> <li> <li> <p> A track record when it comes to launching and sustaining successful podcasts or video series <p> <li> <li> <p> Expert knowledge of a wide range of audio formats and distribution channels Has a finger on the pulse of industry trends and can see ahead 1218 months <p> <li> <li> <p> Has a deep understanding of sports with a fluency in how topics are covered and discussed by fans Has an ear for high quality creative output that resonates with listeners <p> <li> <li> <p> Is an excellent leader who enjoys facilitating the personal development of colleagues <p> <li> <li> <p> Selfstarter with great time management skills <p> <li> <li> <p> Strong attention to detail and highly organized <p> <li> <li> <p> Ability to execute in the short term while planning long term <p> <li> <li> <p> Ability to make difficult decisions for the good of the business <p> <li> <li> <p> Excellent written and verbal communication skills <p> <li> <li> <p> This is a remotebased position in the United States United Kingdom or Canada that may require some travel <p> <li> <ul> <p> <p> <p> <p> <p> <em> The annual base salary range for this role is $18500000 $20000000 USD The total compensation offered for this position may vary based on factors such as education experience skills and location It may also include noncash rewards and benefits The base salary range is subject to change and may be modified in the future <em> <p> <p> <p> <p> <em> The Athletic offers unique perks and benefits to all fulltime employees based on their country of residence Our comprehensive US benefits package includes <em> <p> <p> <p> <p> <em> Highly competitive employercontributed medical dental vision basic life and disability insurance plans <em> <p> <p> <em> Savings accounts for medical wellness and childcare expenses <em> <p> <p> <em> 401k retirement savings plan and employer match <em> <p> <p> <em> Paid time off including paid sick leave 12 paid holidays 15 days of accrued vacation to start and up to 20 weeks of Paid Parental Leave <em> <p> <p> <p> <p> <em> For international candidates Our global benefits packages offer similar benefits and perks competitive to the local market <em> <p> <p> <p> <p> <em> The Athletic Media Company is an equal opportunity employer and enthusiastically encourages people from all backgrounds and experiences to apply The Athletic will consider all applicants without regard to race religion color national origin ancestry physical andor mental disability medical condition genetic information marital status sex gender gender identity gender expression transgender status age sexual orientation military or veteran status or any other protected characteristic under applicable law <em> <p> <p> <p> <p> <em> Click here to review our <em> <a class=fontbold underline fontbold underline postingslink href=httpsprivacytheathleticcompoliciesname=globalprivacypolicywhatinformationdowegatheraboutyou rel=noopener noreferrer nofollow target=blank> <em> Applicant Privacy Notice <em> <a> <em> which describes how and when The Athletic Media Company collects uses and shares certain personal information of job applicants and prospective employees <em> <p> <p> <p> <p> <em> Beware of fraudulent job recruiting schemes Our recruiters use <em> <a class=fontbold underline fontbold underline postingslink href=mailtocareerstheathleticcom rel=noopener noreferrer nofollow target=blank> <em> careerstheathleticcom <em> <a> <em> exclusively We do not conduct interviews via text or instant message and we do not ask candidates to download software to purchase equipment through us or to provide sensitive personally identifiable information such as bank accounts or social security numbers If you have been contacted by someone claiming to be a recruiter with The Athletic but operating from a different email address about a job offer please report it as potential job fraud to the law enforcement and to <em> <a class=fontbold underline fontbold underline postingslink href=mailtopeopletheathleticcom rel=noopener noreferrer nofollow target=blank> <em> peopletheathleticcom <em> <a> <em> <em> <p><p>

Chief Information Security Officer

Company: Grafana Labs

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <p> <strong> About the role <strong> <p> <p> We are looking for a Chief Information Security Officer to lead our Security team reporting to the CTO You will be responsible for developing and implementing security strategies across the Security Engineering Assurance and Security Operations teams as well as liaising with other teams delivering parts of our overall security posture The ideal candidate will have a proven track record of building andor implementing and improving the maturity of security programs in Cloudbased SaaS organizations and possess excellent leadership and communication skills You must have significant engineering acumen as this is a highly technologydriven role <p> <p> Grafana and the LGTM stack continue to be highly successful open source projects and onpremise products with over a million instances of our application running in the wild Grafana is also the main frontend for Grafana Cloud where users can visualize their telemetry data as well as use our opinionated solutions for easier troubleshooting of both their infrastructure and their applications <p> <p> <strong> Responsibilities <strong> <p> <ul> <li> <p> Define and optimize the security strategy in concert with your leadership team ICs and stakeholders across the business <p> <li> <li> <p> Work with customers and prospects to address security concerns Supporting GTM where significant deals require input from the CISO to close <p> <li> <li> <p> Regular 11s coaching and mentoring to ensure your team members are motivated happy and engaged Providing continuous feedback to ensure that they can add value while maintaining high standards <p> <li> <li> <p> Collaborating with our Engineering Leaders and other organization stakeholders to help define and influence wider product strategy roadmaps and designs <p> <li> <li> <p> Lead effective risk management and compliance programs <p> <li> <li> <p> Be actively engaged with significant incidents including preparation simulation response and affected customer notification and communications <p> <li> <li> <p> Maintain executive board and investor relations with regard to security <p> <li> <ul> <p> <strong> Requirements <strong> <p> <ul> <li> <p> You have previous experience as a CISO or CSO at a B2B cloudbased SaaS company IPO experience is a plus <p> <li> <li> <p> While the core focus of the role is on leadership strategy and executive communications you should have enough technical skillsunderstanding of our stack to manage and challenge a highly technical team and help them arrive at strong decisions <p> <li> <li> <p> You approach security with a DevOps mindset You prefer security by enablement automation and guardrails over gates and roadblocks <p> <li> <li> <p> You have familiarity with securing and operating on public Cloud AWS GCP Azure providers with Kubernetes and with securing combined opensource software OSS and SaaS products <p> <li> <li> <p> You will be comfortable working with engineering teams who have a strong sense of autonomy in their decisionmaking be it technical or productfocused <p> <li> <li> <p> You possess domain knowledge of common information security business continuity and privacy management frameworks regulatory requirements and applicable standards such as ISO 27001 SOC 2 HIPAA GDPR PCI FedRamp SOX etc You have experience maintaining these standards while maintaining operational efficiency <p> <li> <li> <p> You are an excellent written and verbal communicator You can articulate complex cybersecurity concepts to both technical and nontechnical audiences You are adept as translating security problems to business impact <p> <li> <ul> <p> <strong> Bonus Points <strong> <p> <ul> <li> <p> A technical background ideally as a software engineer before transitioning into security amp leadership <p> <li> <li> <p> Experience with highly regulated industries such as healthcare the US government and publicly listed companies <p> <li> <li> <p> Working knowledge of Grafana Labs OSS projects and products Experience in using observability tooling to solve security problems <p> <li> <li> <p> Experience working with OSS communities <p> <li> <li> <p> Experience securing large scale distributed systems <p> <li> <ul> <p> In the USA the Base compensation range for this role is $223600 $267000 Actual compensation may vary based on level experience and skillset as assessed in the interview process Benefits include equity bonus if applicable and other benefits listed <a class=fontbold underline fontbold underline fontbold underline href=httpsgrafanacomaboutcareersjobs rel=noopener noreferrer nofollow target=blank> here <a> <p> <p> <em> Compensation ranges are country specific If you are applying for this role from a different location than listed above your recruiter will discuss your specific markets defined pay range amp benefits at the beginning of the process <em> <p><p>

Senior Software Engineer - Ruby on Rails, Backend

Company: Synack

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <p> At Synack we create technology that unleashes the best cybersecurity talent to secure our digital world <p> <p> We protect leading global organizations by reducing companies security risk and increasing their resistance to cyber attack How do we do this By utilizing the worlds best and most trusted team of ethical hackers who test through our powerful and controlled platform to deliver real security without compromise <p> <p> Backed by toptier venture capital firms including Kleiner Perkins Caufield amp Byers Microsoft and Google Ventures Synacks mission is to leverage global security talent coupled with advanced technology to help enterprises discover security vulnerabilities before they become business problems Discover the possibilities at Synack <p> <p> Are you ready to leverage your software development skills to build a platform that is transforming cybersecurity As a Senior Software Engineer Ruby on Rails Backend you will be part of a fastpaced collaborative team developing our cybersecurity platforms You will be a critical contributor to the development of the system while implementing engineering best practices If you enjoy pivoting between different problems and meeting new challenges every day while developing a solution that is mission critical to the organization this role is for you Sounds interesting Keep reading <p> <p> <strong> Please note <strong> This is a remote position based in the US We can only hire US citizens for this position due to federal government contract requirements <p> <p> <p> <p> <strong> Heres what youll do <strong> <p> <ul> <li> <p> Design develop and maintain highly scalable and available microservices hosted on Google Cloud Platform and Azure <p> <li> <li> <p> Collaborate with the product team and engineering leadership in requirements gathering planning and estimation <p> <li> <li> <p> Architect and implement business logic in Ruby on Rails backend and Relational data store <p> <li> <li> <p> Develop and evolve APIs to interface with Web UI <p> <li> <li> <p> Write clean maintainable and efficient code following our coding standards <p> <li> <li> <p> Identify and resolve performance bottlenecks bugs and backend issues <p> <li> <li> <p> Participate in system design code reviews and production releases <p> <li> <li> <p> Contribute to our technical documentation and update system and data flow diagrams as you introduce new features <p> <li> <ul> <p> <strong> Heres what youll need <strong> <p> <ul> <li> <p> 8+ years designing and building dynamic production solutions <p> <li> <li> <p> Solid understanding of objectoriented programming <p> <li> <li> <p> 8+ years in a Ruby on Rails <p> <li> <li> <p> 2+ years experience with building and deploying containerized applications K8s is a bonus <p> <li> <li> <p> Solid backend experience with background jobs processors such as SideKiq <p> <li> <li> <p> Experience with queue and messaging solutions such as PubSubKafka <p> <li> <li> <p> Experience designing and building RESTful APIs <p> <li> <li> <p> Experience with testing tools such as Rspec Jest TestCafe React Testing Library <p> <li> <li> <p> Understanding of various database systems such as RDBMS and NOSQL <p> <li> <li> <p> Experience working with cloud hosted environments <p> <li> <ul> <p> <strong> Great to have <strong> <p> <ul> <li> <p> 2+ years using ReactJSRedux or other JavaScript frameworks and libraries <p> <li> <li> <p> 2+ years of experience with Golang <p> <li> <li> <p> Experience with GCP <p> <li> <li> <p> Experience working in Cyber security problem space <p> <li> <ul> <p> <strong> Ready to join us <strong> <p> <p> Synack is committed to embracing diversity Our people are our strength Each addition to our team is an opportunity to grow and diversify our ideas experiences and viewpoints We strive to be inclusive of Race Ethnicity Religion Sex LGBTQ+ Veterans Disabilities and Age Synack welcomes you <p> <p> As a candidate Synack cares about your privacy Please view our candidate privacy policy <a class=fontbold underline fontbold underline fontbold underline href=httpswwwsynackcomcandidateprivacynotice rel=noopener noreferrer nofollow target=blank> here <a> <p> <p> <strong> $115000 $230000 py <strong> Salary is determined by a combination of factors including location level relevant experience and skills The range displayed on each job posting reflects the minimum and maximum target for new hire salaries for the position across all US locations The compensation package for this position may also include equity and benefits For more details about our benefits please see <a class=fontbold underline fontbold underline fontbold underline href=httpssynackmybenefitslife rel=noopener noreferrer nofollow target=blank> here <a> Then for the Employer code enter <strong> synack <strong> <p><p>

Sr. Group Product Manager - Growth

Company: iHerb

Location: USA

Posted Apr 29, 2024

<p class=jobDescription> <p> <strong> Job Summary <strong> <p> <p> The Senior Group Product Manager Growth at iHerb will play a key role in accelerating business growth by defining a product strategy and leading a team to drive innovation and product optimization across our global markets The role requires a strategic thinker with expertise in productled growth a passion for improving user experiences and a strong understanding of the competitive landscape to meet the needs of our customers <p> <p> <strong> Job Expectations <strong> <p> <p> <strong> Strategic Planning <strong> Develop a product strategy aligned with overall business objectives to drive ecommerce growth across international markets <p> <p> <strong> Inspirational Leadership <strong> Provide guidance mentorship and support to team members fostering a collaborative work environment <p> <p> <strong> Experimentation amp Optimization <strong> Run AB tests analyze results and iterate on ideas to improve existing products and enhance the user experience <p> <p> <strong> Data Analysis <strong> Adept at gathering qualitative and quantitative data to draw insights and identify opportunities for growth track key performance metrics and enhance product features <p> <p> <strong> Collaboration <strong> Work closely with executive leadership to gain big picture alignment and investment decisions with the companys strategic priorities and vision for future growth Collaborate with crossfunctional teams to ensure successful product launches and ongoing optimization <p> <p> <strong> Innovation and Disruption <strong> Champion a culture of innovation by encouraging outofthebox thinking exploring emerging technologies and challenging the status quo Drive the ideation and implementation of innovative features products and business models to expand product market reach <p> <p> The duties and responsibilities described above may provide only a partial description of this position This is not an exhaustive list of all aspects of the job Other duties and responsibilities not outlined in this document may be added as necessary or desirable with or without notice <p> <p> <strong> Knowledge Skills and Abilities <strong> <p> <p> Required <p> <ul> <li> <p> Experience crafting a compelling product vision amp strategy with a track record of delivering on growth initiatives aligned to the companys goals and objectives <p> <li> <li> <p> Entrepreneurial mindset and strong product sense with a proven ability to lead a team in developing and executing on growth plans while remaining agile in a fastpaced and dynamic environment <p> <li> <li> <p> Ability to inspire and influence through effective communication including consensus building and communicating complex details in a way that builds trust and confidence <p> <li> <li> <p> Creative problem solver with a strong sense of urgency who can take a pragmatic and customercentric approach when weighing and articulating tradeoffs <p> <li> <li> <p> Proven track record of experimentation including hypothesis generation and performing data analysis to continuously learn and iterate <p> <li> <li> <p> Can establish and track KPIs that demonstrate the overall health amp performance of a product or portfolio <p> <li> <li> <p> Expertise in software development processes and agile methodologies <p> <li> <li> <p> Strong understanding of development technologies and distributed webbased systems <p> <li> <li> <p> Experience collaborating with a crossfunctional team comprised of but not limited to Engineering UXUI Marketing Customer Support Legal amp Compliance to ensure growth goals are met <p> <li> <li> <p> Experience managing direct reports <p> <li> <ul> <p> <strong> Equipment Knowledge <strong> <p> <ul> <li> <p> Experience with Agile collaboration tools <p> <li> <li> <p> Experience with Microsoft Office Suite Word Excel PowerPoint <p> <li> <li> <p> Experience with Google Business Suite Gmail Drive Docs Sheets Forms preferred <p> <li> <ul> <p> <strong> Experience Requirements <strong> <p> <p> Generally requires seven 7 + years of Product Management experience preferably in global ecommerce setting <p> <p> LIJC1 <p><p>

Data Security Engineer

Company: The Motley Fool Inc

Location: USA

Posted Apr 29, 2024

The Motley Fool is seeking a senior-level Freelance Data Security Engineer with expertise in BigID data discovery, relational databases, data analytics, and compliance frameworks. The role involves designing and implementing robust security measures, leading data governance, conducting risk assessments, and collaborating with various departments. The ideal candidate should have a minimum of 5 years of relevant experience, strong technical skills, and excellent communication abilities. The position is 100% remote but requires US-based candidates. The compensation range is $80-$95 USD per hour.

Senior Software Engineer - Invoices

Company: Mercury

Location: USA

Posted Apr 29, 2024

<p class=jobDescription> <p> Since the dawn of aviation pilots have faced the constant challenge of air resistance much like sailors navigating the friction of water Amidst this relentless struggle the <em> trim tab <em> emerges as an ingenious yet understated marvel Just as the wheel revolutionized transportation by easing movement over land the <em> trim tab <em> simplifies flight allowing for smoother navigation through the skies It embodies the elegance of simplicity in engineering transforming the demanding task of controlling an aircraft into a more graceful and manageable endeavor <p> <p> At Mercury we are committed to crafting an exceptional banking experience for startups Our team is passionately focused on ensuring our product not only meets but anticipates the needs of our customers <p> <p> The invoicing team is a new initiative at Mercury building a new product vertical on top of our banking foundations Were a team of pragmatic fullstack engineers motivated by the desire to create a lovable product that rescues our customers from frustrating expensive legacy invoicing tools <p> <p> <strong> As part of this role you will <strong> <p> <ul> <li> <p> Help create Mercurys second act the financial system to power startups <p> <li> <li> <p> Join a smallbutmighty team of experienced full stack product engineers creating Mercurys brand new invoicing product <p> <li> <li> <p> Feel a strong sense of product ownership and actively seek responsibility we often selforganize on smallmedium projects and we want someone whos excited to help shape and build Mercurys future <p> <li> <li> <p> Work closely with designers and product leaders to ship lovable experiences We want to transcend the status quo for banking and fintech software and many of our customers are startups and appreciate our slick magical designs <p> <li> <ul> <p> <strong> The ideal candidate for the role <strong> <p> <ul> <li> <p> Has at least 4 years of backend frontend or fullstack development experience with excitement to learn and work with Haskell React and TypeScript <p> <li> <li> <p> Is passionately product minded and has experience building and shipping new products <p> <li> <li> <p> Empathizes with users and can channel their perspective to build lovable products <p> <li> <li> <p> Can balance tradeoffs and find creative solutions to accomplish goals <p> <li> <li> <p> Communicates and collaborates effectively with peers and cross functional counterparts <p> <li> <ul> <p> If this role interests you we invite you to explore our public demo at <a class=fontbold underline fontbold underline fontbold underline href=httpsdemomercurycom rel=noopener noreferrer nofollow target=blank> demomercurycom <a> <p> <p> The total rewards package at Mercury includes base salary equity stock options and benefits Our salary and equity ranges are highly competitive within the SaaS and fintech industry and are updated regularly using the most reliable compensation survey data for our industry New hire offers are made based on a candidates experience expertise geographic location and internal pay equity relative to peers <p> <p> Our target new hire base salary ranges for this role are the following <p> <ul> <li> <p> US employees any location $203100 $238900 <p> <li> <li> <p> Canadian employees any location CAD $184800 $217400 <p> <li> <ul> <p> <em> Mercury is a financial technology company not a bank Banking services provided by Choice Financial Group and Evolve Bank amp Trust Members FDIC <em> <p> <p> <p> <p> LIDNI <p><p>

Senior Backend Engineer - Styles

Company: Webflow

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <p> At Webflow our mission is to bring development superpowers to everyone Webflow is the leading visual development platform for building powerful websites without writing code By combining modern web development technologies into one platform Webflow enables people to build websites visually saving engineering time while clean code seamlessly generates in the background From independent designers and creative agencies to Fortune 500 companies millions worldwide use Webflow to be more nimble creative and collaborative Its the web made better <p> <p> The Styles team is responsible for building and investing in the design capabilities of our core product to empower millions of designers worldwide to easily adopt Webflow to build manage and scale any number of sites efficiently <p> <p> Were looking for a Senior Backend Engineer to join the Styles team and lead the team to deliver impactful features for our customers to build highly personalized web experiences In this role you will execute the technical direction and be a mentor amp partner to other engineers on the team Additionally you will help lead crossfunctional efforts to drive even greater impact <p> <h2> <strong> About the role <strong> <h2> <ul> <li> <p> Location Remotefirst United States BC amp ON Canada <p> <li> <li> <p> Fulltime <p> <li> <li> <p> Permanent <p> <li> <li> <p> Exempt US Candidates <p> <li> <li> <p> Reporting to the Engineering Manager of Designer UX team <p> <li> <li> <p> The cash compensation for this role is tailored to align with the cost of labor in different geographic markets Weve structured the base pay ranges for this role into zones for our geographic markets and the specific base pay within the range will be determined by the candidates geographic location jobrelated experience knowledge qualifications and skills <p> <ul> <li> <p> Zone A $162500 $216050 <p> <li> <li> <p> Zone B $152700 $203100 <p> <li> <li> <p> Zone C $143000 $190150 <p> <li> <ul> <ul> <li> <p> CAD 184600 CAD 245500 <p> <li> <ul> <ul> <li> <p> United States all figures cited below in USD and pertain to workers in the United States <p> <li> <li> <p> Canada All figures cited below in CAD and pertain to workers in ON amp BC Canada <p> <li> <ul> <li> <ul> <p> Please visit our <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowaboutwebflowiocareers rel=noopener noreferrer nofollow target=blank> Careers page <a> for more information on which locations are included in each of our geographic pay zones However please confirm the zone for your specific location with your recruiter <p> <p> As a Senior Backend Engineer youll <p> <ul> <li> <p> Design and implement scalable backend services <p> <li> <li> <p> Drive crosspillar collaboration with software engineers product managers designers and QA analysts in an autonomous supportive team environment <p> <li> <li> <p> Effectively communicate team priorities and strategy to engineering and crossfunctional leadership teams <p> <li> <li> <p> Build and maintain unit and integration tests <p> <li> <li> <p> Provide clarity on processes and priorities to crosspillar partners and other engineers on the team <p> <li> <li> <p> Mentor other engineers on best practices code design considerations and quality <p> <li> <ul> <p> In addition to the responsibilities outlined above at Webflow we will support you in identifying where your interests and development opportunities lie and well help you incorporate them into your role <p> <h2> <strong> About you <strong> <h2> <p> Youll thrive as a Senior Backend Engineer Styles if you <p> <ul> <li> <p> Have 5+ years of experience in scalable multitenant environments <p> <li> <li> <p> Have 2+ years experience working with feature teams on customerfacing products shipping and iterating to solve customer problems <p> <li> <li> <p> Value testing and documentation equally as much as your code <p> <li> <li> <p> Are comfortable with ambiguity and scoping solutions with your teammates <p> <li> <li> <p> Are comfortable working on JavascriptTypescript MongoDB and Node <p> <li> <li> <p> Have consistently communicated trade offs throughout a project to meet both technical and business requirements <p> <li> <li> <p> Enjoy highvisibility work and presenting to executive counterparts <p> <li> <li> <p> Get excited about encouraging and developing other engineers <p> <li> <ul> <p> Even if you dont meet 100 of the above qualifications you should still seriously consider applying Research shows that you may still be considered for a role if you meet just half of the requirements <p> <p> <strong> Our Core Behaviors <strong> <p> <ul> <li> <p> <strong> Obsess over customer experience <strong> We deeply understand what were building and who were building for and serving We define the leading edge of whats possible in our industry and deliver the future for our customers <p> <li> <li> <p> <strong> Move with heartfelt urgency <strong> We have a healthy relationship with impatience channeling it thoughtfully to show up better and faster for our customers and for each other Time is the most limited thing we have and we make the most of every moment <p> <li> <li> <p> <strong> Say the hard thing with care <strong> Our best work often comes from intelligent debate critique and even difficult conversations We speak our minds and dont sugarcoat things and we do so with respect maturity and care <p> <li> <li> <p> <strong> Make your mark <strong> We seek out new and unique ways to create meaningful impact and we champion the same from our colleagues We work as a team to get the job done and we go out of our way to celebrate and reward those going above and beyond for our customers and our teammates <p> <li> <ul> <h3> <strong> Benefits amp wellness <strong> <h3> <ul> <li> <p> Equity ownership RSUs in a growing privatelyowned company <p> <li> <li> <p> 100 employerpaid healthcare vision and dental insurance coverage for employees and dependents fulltime employees working 30+ hours per week as well as Health Savings AccountHealth Reimbursement Account dependent care Flexible Spending Account US only dependent on insurance plan selection where applicable in the respective country of employment Employees may also have voluntary insurance options such as life disability hospital protection accident and critical illness where applicable in the respective country of employment <p> <li> <li> <p> 12 weeks of paid parental leave for both birthing and nonbirthing caregivers as well as an additional 68 weeks of pregnancy disability for birthing parents to be used before child bonding leave where local requirements are more generous employees receive the greater benefit Employees also have access to family planning care and reimbursement <p> <li> <li> <p> Flexible PTO with a mandatory annual minimum of 10 days paid time off for all locations where local requirements are more generous employees receive the greater benefit and sabbatical program <p> <li> <li> <p> Access to mental wellness and professional coaching therapy and Employee Assistance Program <p> <li> <li> <p> Monthly stipends to support health and wellness smart work and professional growth <p> <li> <li> <p> Professional career coaching internal learning amp development programs <p> <li> <li> <p> 401k plan and pension schemes in countries where statutorily required financial wellness benefits like CPA or financial advisor coverage <p> <li> <li> <p> Discounted Pet Insurance offering US only <p> <li> <li> <p> Commuter benefits for inoffice employees <p> <li> <ul> <p> <em> Temporary employees are not eligible for paid holiday time off accrued paid time off paid leaves of absence or companysponsored perks unless otherwise required by law <em> <p> <h3> <strong> Be you with us <strong> <h3> <p> At Webflow equality is a core tenet of our culture We are an Equal Opportunity EEOVeteransDisabled Employer and are <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomdiversityequityinclusion rel=noopener noreferrer nofollow target=blank> committed <a> to building an inclusive global team that represents a variety of backgrounds perspectives beliefs and experiences Employment decisions are made on the basis of jobrelated criteria without regard to race color religion sex sexual orientation gender identity national origin disability veteran status or any other classification protected by applicable law Pursuant to the San Francisco Fair Chance Ordinance Webflow will consider for employment qualified applicants with arrest and conviction records <p> <h3> <strong> Stay connected <strong> <h3> <p> Not ready to apply but want to be part of the Webflow community Consider following our story on our <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomblog rel=noopener noreferrer nofollow target=blank> Webflow Blog <a> <a class=fontbold underline fontbold underline fontbold underline href=httpswwwlinkedincomcompanywebflowinc rel=noopener noreferrer nofollow target=blank> LinkedIn <a> <a class=fontbold underline fontbold underline fontbold underline href=httpstwittercomwebflow rel=noopener noreferrer nofollow target=blank> X Twitter <a> andor <a class=fontbold underline fontbold underline fontbold underline href=httpswwwglassdoorcomReviewsWebflowReviewsE890506htm rel=noopener noreferrer nofollow target=blank> Glassdoor <a> <p> <h3> <strong> Please note <strong> <h3> <p> <em> We will ensure that individuals with disabilities are provided reasonable accommodation to participate in the job application or interview process to perform essential job functions and to receive other benefits and privileges of employment Upon interview scheduling instructions for confidential accommodation requests will be administered <em> <p> <p> <em> To join Webflow youll need a valid right to work authorization depending on the country of employment <em> <p> <p> <em> If you are extended an offer that offer may be contingent upon your successful completion of a background check which will be conducted in accordance with applicable laws We may obtain one or more background screening reports about you solely for employment purposes <em> <p> <p> <em> For information about how Webflow processes your personal information please review <em> <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomlegalapplicantprivacynotice rel=noopener noreferrer nofollow target=blank> <em> Webflows Applicant Privacy Notice <em> <a> <em> <em> <p><p>

Senior Software Engineer - AI

Company: Synack

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <p> At Synack we create technology that unleashes the best cybersecurity talent to secure our digital world <p> <p> We protect leading global organizations by reducing companies security risk and increasing their resistance to cyber attack How do we do this By utilizing the worlds best and most trusted team of ethical hackers who test through our powerful and controlled platform to deliver real security without compromise <p> <p> Backed by toptier venture capital firms including Kleiner Perkins Caufield amp Byers Microsoft and Google Ventures Synacks mission is to leverage global security talent coupled with advanced technology to help enterprises discover security vulnerabilities before they become business problems Discover the possibilities at Synack <p> <p> We are looking for a Senior Software Engineer AI where youll be spearheading the development of cuttingedge AIdriven solutions tailored for the offensive security sector This role demands a handson approach to designing developing and deploying machine learning models that address specific cybersecurity challenges enhancing our product offerings and meeting our customers critical needs Youll lead by example mentoring junior engineers and promoting a culture of technical excellence innovation and continuous improvement <p> <p> Sounds interesting Keep reading <p> <p> <strong> Please note <strong> This is a remote position based in the US We can only hire US citizens for this position due to federal government contract requirements <p> <p> <p> <p> <strong> Heres what youll do <strong> <p> <ul> <li> <p> Design implement and deliver scalable AI and machine learning solutions <p> <li> <li> <p> Develop robust AI models capable of identifying vulnerabilities automating penetration testing processes workflow optimization and enhancing threat intelligence <p> <li> <li> <p> Own and drive the endtoend development of AI product features from ideation to deployment monitoring and model management <p> <li> <li> <p> Actively participate in and contribute to design and implementation of AI solutions promoting best practices during the project lifecycle <p> <li> <li> <p> Lead technical discussions code reviews and design sessions sharing your expertise to uplift the teams capabilities <p> <li> <li> <p> Provide mentorship and support to junior engineers encouraging professional growth and development <p> <li> <li> <p> Collaborate closely with crossfunctional teams to integrate AI capabilities into broader systems and applications <p> <li> <ul> <p> <strong> Heres what youll need <strong> <p> <ul> <li> <p> 10+ years of experience in machine learning engineering with a strong foundation in statistics mathematics or a related field <p> <li> <li> <p> 3+ years of demonstrated experience in designing and implementing machine learning models and data pipelines in production environments <p> <li> <li> <p> Excellent problemsolving skills with the ability to translate complex business requirements into technical solutions <p> <li> <li> <p> Strong communication skills capable of presenting findings and insights to both technical and nontechnical audiences <p> <li> <li> <p> Proficient in Python and strong understanding of AI and machine learning algorithms and frameworks eg Tensorflow PyTorch <p> <li> <li> <p> Strong knowledge of data management systems both SQL eg PostgreSQL and NoSQL egMongoDB <p> <li> <li> <p> Demonstrated ability to work effectively in a teamoriented collaborative environment <p> <li> <ul> <p> <strong> Nice To Have <strong> <p> <ul> <li> <p> Expertise in AI and ML technologies especially Azure AI and Open AI demonstrating the ability to integrate into software solutions <p> <li> <li> <p> Interest or experience in Cyber Security <p> <li> <ul> <p> <strong> Ready to join us <strong> <p> <p> Synack is committed to embracing diversity Our people are our strength Each addition to our team is an opportunity to grow and diversify our ideas experiences and viewpoints We strive to be inclusive of Race Ethnicity Religion Sex LGBTQ+ Veterans Disabilities and Age Synack welcomes you <p> <p> As a candidate Synack cares about your privacy Please view our candidate privacy policy <a class=fontbold underline fontbold underline fontbold underline href=httpswwwsynackcomcandidateprivacynotice rel=noopener noreferrer nofollow target=blank> here <a> <p> <p> <strong> $145000 $235000 py <strong> Salary is determined by a combination of factors including location level relevant experience and skills The range displayed on each job posting reflects the minimum and maximum target for new hire salaries for the position across all US locations The compensation package for this position may also include equity and benefits For more details about our benefits please see <a class=fontbold underline fontbold underline fontbold underline href=httpssynackmybenefitslife rel=noopener noreferrer nofollow target=blank> here <a> Then for the Employer code enter <strong> synack <strong> <p><p>

Principal Software Engineer

Company: RapidAI

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <p> RapidAI is the global leader in using AI to combat lifethreatening vascular and neurovascular conditions RapidAI is empowering physicians to make faster decisions for better patient outcomes leading the next evolution of clinical decisionmaking and patient workflow Based on intelligence gained from over 10 million scans in more than 2000 hospitals in over 60 countries the Rapid® platform transforms care coordination offering care teams a level of patient visibility never before possible RapidAI where AI meets patient care <p> <p> <p> <p> <p> <p> <strong> What you will do <strong> <p> <ul> <li> <p> Design complex scalable software systems and architectures Evaluate existing architectures and propose improvements Ensure technical decisions align with product roadmap <p> <li> <li> <p> Plan technical projects and milestone deliverables in alignment with product managers Coordinate engineers and their tasks and monitor overall progress <p> <li> <li> <p> Design and build impactful technical solutions and own them through the entire development lifecycle <p> <li> <li> <p> Develop complex features and components Review code and designs developed by other engineers Debug difficult issues across the codebase <p> <li> <li> <p> Research the latest technologies and propose ways to integrate them to improve the product Come up with solutions for technical challenges and improvements <p> <li> <li> <p> Provide technical guidance and mentorship to other engineers Establish engineering best practices and standards <p> <li> <li> <p> Clearly communicate complex technical concepts and designs to both technical and nontechnical audiences Collaborate cross functionally across product program management and other teams <p> <li> <li> <p> Establish quality standards design review checklists code review processes etc Monitor system performance and ensure quality goals are met Drive continuous improvement <p> <li> <ul> <p> <p> <p> <strong> What you bring <strong> <p> <ul> <li> <p> Bachelors Degree or equivalent <p> <li> <li> <p> 12+ years of experience in software development and demonstrated engineering leadership <p> <li> <li> <p> 8+ years of experience in backend development <p> <li> <li> <p> 3+ years in using Typescript and Amazon AWS <p> <li> <li> <p> High level of skill in at least one generalpurpose backend language and one frontend language but willingness to work with other languages if required <p> <li> <li> <p> High level of distributed system design skill <p> <li> <li> <p> Creating platforms reusable libraries and utilities wherever applicable <p> <li> <li> <p> Writing highquality code that is modular functional and testable <p> <li> <li> <p> Troubleshoot issues effectively in a distributed architecture <p> <li> <li> <p> Communicate collaborate and work effectively in a global environment <p> <li> <li> <p> Solid analytical and reasoning skills for design troubleshooting and root cause analysis <p> <li> <li> <p> Great communication skills with technical and nontechnical teams <p> <li> <ul> <p> <p> <p> <strong> Bonus Skills <strong> <p> <ul> <li> <p> iOS or Android development experience Swift Kotlin and good understanding of Native mobile <p> <li> <li> <p> Experience in a regulated software environment eg medical device aerospace defense automotive <p> <li> <li> <p> Experience with DICOM HL7 or other medical data formatsprotocols <p> <li> <ul> <p> <p> <p> <strong> What we offer you <strong> <p> <ul> <li> <p> RapidAI pays 100 for employee coverage amp 75 for your dependent coverage for medical dental amp vision premiums <p> <li> <li> <p> Medical Benefits We offer a range of policies through TriNet <p> <li> <li> <p> Life InsuranceADampD is 1X times your annual salary <p> <li> <li> <p> We pay 100 for Short and Long Term Disability <p> <li> <li> <p> Healthcare and Dependent care flexible spending accounts are available <p> <li> <li> <p> A 401k plan is offered through Empower <p> <li> <li> <p> RapidAI provides $100 a month for internetcellphone services <p> <li> <ul> <p> Time Off <p> <ul> <li> <p> We have 10 company paid holidays <p> <li> <li> <p> RapidAI has a flexible vacation policy We urge employees to take vacation Vacation allows employees to renew reinvigorate and rejuvenate <p> <li> <ul> <p> Other Cool Benefits <p> <ul> <li> <p> Equity Stock Options <p> <li> <li> <p> Incentive Compensation <p> <li> <li> <p> And most importantly You are joining an awesome team <p> <li> <ul> <p> <p> <p> <p> <p> <strong> Compensation <strong> The salary range target for the role described in this job description is $200000 to $208000 Final offer amounts depend on multiple factors including but not limited to candidate experience and expertise geographic location compensationequity mix and market data This position may also be eligible for additional incentives such as equity awards shortterm incentives or sales compensation <p> <p> <p> <p> RapidAI is committed to creating an inclusive and diverse workplace We provide equal employment opportunities to all employees and applicants and prohibit discrimination and harassment of any type in regard to race color religion age sex national origin disability status genetics protected veteran status sexual orientation gender identity or expression or any other characteristic protected by federal state or local laws <p> <p> <p> <p> Please review our CPRA policies <a class=fontbold underline fontbold underline postingslink href=httpsrapidaiboxcomsbc5l0izmwcyf8mu34sbsalmzx4ly1mkl rel=noopener noreferrer nofollow target=blank> here <a> <p> <p> For more information on the information we collect about our applicants and how we use it see our CPRA Privacy Notice <a class=fontbold underline fontbold underline postingslink href=httpsrapidaiboxcomslpyfu84mmopywvcox0i4ej15c4v84ck1 rel=noopener noreferrer nofollow target=blank> here <a> <p><p>

Staff Software Engineer - Foundation

Company: Apollo

Location: USA

Posted Apr 29, 2024

<p class=jobDescription> <p> Are you a talented and driven distributed systems engineer with a proven track record capable of leading crossorganizational features Does tech debt quiver in its boots at the sound of your name Do you butter your bread with evented systems Have the letters C Q R and S been ruined for you in an eventually consistent manner Have we got news for you youre not alone <p> <p> <p> <p> In this highimpact role youll be a leader on our Platform Engineering team Youll help foster our best Platform Engineers think SRE meets Ops with a heavy focus on automation of everything setting a consistent example for how we lead projects and how we maintain our documents dashboards and code bases Our teams current focus is on Service Delivery Kubernetes Infrastructure Management Terraform CICD Argo Atlantis and in general all things SLOs and Operational Excellence Your teammates are talented folks who value code that is 80 of the value for 20 of the work designs that are forwardthinking enough to be easily flexible for the next features and leadership with a healthy dose of mindfulness and humility <p> <p> <p> <p> Apollo is the worldwide leader of GraphQL innovation Companies like Netflix Walmart Expedia Peloton DoorDash The New York Times and Zillow are just a small sample of Apollos customers Our opensource product has millions of downloads every week According to the new Gartner report by 2027 more than 60 of enterprises will use GraphQL in production up from less than 30 in 2024 and 30 of those enterprises will be using GraphQL federation which Apollo pioneered <p> <p> <p> <p> GraphQL is transforming the software development space by creating a brand new layer in companies stacks called the supergraph that helps engineering teams ship faster and build richer experiences than ever before Join us and build the future of Apollos internal Developer Platform <p> <p> <p> <p> <p> <p> <strong> What Youll Do <strong> <p> <ul> <li> <p> Youll become a key Domain owner for the team taking responsibility for our cloud infrastructure in partnership with our Platform Security team and especially for our Service Delivery Platform namely K8s <p> <li> <li> <p> You will lead crossteam groups of developers and shepherd largeimpact initiatives along either as the technical leader or coaching members of the team to become technical leaders <p> <li> <li> <p> Youll mentor junior members of the team and help with interviewing potential teammates <p> <li> <li> <p> Youll create technical designs that proactively address cost efficiency security and observability <p> <li> <li> <p> Youll deliver technical plans onepagers DRs and other artifacts <p> <li> <li> <p> Youll work with Kubernetes GCP Helm Terraform DataDog ArgoCD CircleCI Atlantis Docker the list goes on to deliver your work <p> <li> <li> <p> Youll be responsible for improving developer velocity across the company leveraging frameworks like DORA and hardening our reliability and observability <p> <li> <li> <p> Youll participate in oncall rotation <p> <li> <ul> <p> <p> <p> <strong> About You <strong> <p> <ul> <li> <p> You have proven systems expertise and experience with statelessfault tolerant systems as well as working familiarity with eventing patterns and distributed paradigms <p> <li> <li> <p> You are adept at weighing technical and business tradeoffs and are exceptional at seeing down the road and around corners <p> <li> <li> <p> You enjoy crossteam collaboration and believe in a rising tides lifts all boats mentality Youre a joy to those around you bringing everyone along for the ride <p> <li> <li> <p> You are dataoriented and leverage data to make decisions in a concrete way <p> <li> <li> <p> You are an expert with Kubernetes GCP preferably but AWS or Azure is great too and Terraform <p> <li> <li> <p> Bonus points for Helm Docker ArgoCD CircleCI DataDog and of course GraphQL <p> <li> <ul> <p> <p> <p> <p> <p> $167000 $212000 a year <p> <p> At Apollo we strive to provide competitive marketinformed compensation whilst ensuring consistency within the team in each country We make hiring decisions based on your skills experience and our overall assessment of what we learned during the hiring process <p> <p> <p> <p> In addition to the US base salary range we also provide equity and benefits Apollo offers all US employees a choice of 3 Anthem Blue Cross medical plans and California residents can also choose from an additional 2 Kaiser medical plans Dental and Vision benefits are provided by Sun Life Financial <p> <p> <p> <p> Location This is a remote position that can be done from anywhere in the United States or Canada <p> <p> <p> <p> Equal Opportunity Apollo is proud to be an equal opportunity workplace dedicated to pursuing and hiring a talented and diverse workforce <p> <p> <p> <p> Privacy California residents applying for positions at Apollo can see our privacy policy <a class=fontbold underline fontbold underline postingslink href=httpswwwapollographqlcomCCPAPrivacyNoticeforEmployeespdf rel=noopener noreferrer nofollow target=blank> here <a> <p> <p> <p> <p> EVerify Apollo is an EVerify employer and will provide the federal government with your Form I9 information to confirm that you are authorized to work in the US For more information please visit <a class=fontbold underline fontbold underline postingslink href=httpswwweverifygov rel=noopener noreferrer nofollow target=blank> EVerify <a> <p><p>

Frequently Asked Questions

What are typical salary ranges by seniority for Public Notice Flyer roles?
Entry‑level designers earn between $35,000 and $45,000 annually; mid‑level coordinators range from $55,000 to $70,000; senior specialists and project leads command $75,000 to $95,000, with bonuses tied to compliance audit scores.
Which skills and certifications are required for Public Notice Flyer positions?
Proficiency in Adobe InDesign, Canva, and Microsoft Publisher is essential. GIS mapping with ArcGIS, QR‑code generation, and knowledge of ADA compliance are valued. Certifications such as Adobe Certified Expert (ACE), Certified Public Notice Specialist (CPNS), and OSHA safety credentials strengthen a résumé.
Is remote work available for Public Notice Flyer roles?
Many firms allow hybrid or fully remote arrangements for design and coordination tasks, but onsite visits are often needed for community liaison meetings, permit approvals, and final flyer approvals at municipal offices.
What career progression paths exist within Public Notice Flyer?
Typical paths begin with Junior Designer, advance to Senior Designer or Notice Coordinator, then to Compliance Project Manager, and ultimately to Director of Public Communications or Municipal Planning Lead, with opportunities to specialize in digital notice systems or regulatory strategy.
What industry trends are shaping the future of Public Notice Flyer work?
The sector is moving toward fully digital notice systems, integrating GIS-based distribution, QR‑code access, and AI‑generated content for speed and accuracy. Growing emphasis on sustainability reporting, data analytics for audience reach, and compliance with e‑government regulations are also driving demand for specialized expertise.

Related Pages