Public Safety Ensured Jobs in USA
250,518 open positions · Updated daily
Looking for Public Safety Ensured jobs in USA? Browse our curated listings with transparent salary information to find the perfect Public Safety Ensured position in the USA area.
Engineering Manager - Developer Platform
Company: Reddit
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> Reddit has an amazing history of individual and communitydriven innovation With no official support thousands of user scripts selfidentified bots and services run against our API and enrich the experience Redditors have on our platform Furthermore the value of Reddit data has powered the creation and growth of numerous businesses The goal of the Reddit Developer Platform team is to further empower communities to innovate while establishing a significant new business centered on our Data API <p> <p> This role can be remote within the United States or Canada or can be a hybrid model if near an office Offices are located in San Francisco Los Angeles Chicago New York City and Toronto <p> <p> We are looking for an experienced Engineering Manager with a strong technical background to lead reliability for our Data API You will play a pivotal role in not only evolving the existing Data API but also spearheading initiatives to monetize API products effectively This is a unique opportunity to join a key pillar of one of the most important consumer products on the Internet <p> <p> <strong> What Youll Be Doing <strong> <p> <ul> <li> <p> Building data and streaming data products for a variety of external enterprise customers who are looking for realtime access to Reddits content and usage <p> <li> <li> <p> Evolving Reddits public API and capabilities towards a cleaner more elegant Developer Experience <p> <li> <li> <p> Making a platform that is highly available low on latency and at internet scale <p> <li> <li> <p> Laying the technical foundation for future features and experiences such as enterprise search over Reddit data <p> <li> <ul> <p> <strong> What We Expect From You <strong> <p> <ul> <li> <p> 8+ years of industry experience preferably building maintaining and managing platforms and infrastructure <p> <li> <li> <p> 2+ years of experience managing engineering teams <p> <li> <li> <p> 2+ years of experience in a consumer internet data or streaming platform at highscale <p> <li> <li> <p> 2+ years of experience using Kafka Flink or similar streaming data infrastructure <p> <li> <li> <p> Strong experience in architecting and delivering scalable solutions using cloud providers such as AWS GCP Azure and likely Kubernetes <p> <li> <li> <p> Solid understanding of DevOps principles CICD pipelines and infrastructure automation <p> <li> <li> <p> Youre highly technical enough to solve many problems your team has yourself but you prefer to guide your team into solving them <p> <li> <li> <p> Youre highagency selfdirected detailoriented and reliable <p> <li> <ul> <p> <strong> Responsibilities <strong> <p> <ul> <li> <p> Build and manage a team of 78 engineers hiring topnotch individual contributors and giving them room to shine <p> <li> <li> <p> Build and execute a technical roadmap of systems improvements <p> <li> <li> <p> Be the owner and steward of reliability for Reddits Data API product suite <p> <li> <li> <p> Be the crossfunctional face of your team to stakeholders across Product BD and more <p> <li> <ul> <p> <strong> Bonus Points <strong> <p> <ul> <li> <p> Experience in influencing larger organizations on technical directionbest practices <p> <li> <li> <p> Deep technical contributions to open source or published projects <p> <li> <ul> <p> <strong> Benefits <strong> <p> <ul> <li> <p> Comprehensive Healthcare Benefits <p> <li> <li> <p> 401k Matching <p> <li> <li> <p> Workspace benefits for your home office <p> <li> <li> <p> Personal amp Professional development funds <p> <li> <li> <p> Family Planning Support <p> <li> <li> <p> Flexible Vacation please use them amp Reddit Global Wellness Days <p> <li> <li> <p> 4+ months paid Parental Leave <p> <li> <li> <p> Paid Volunteer time off <p> <li> <ul> <p> LIRemote LIJD3 <p><p>
Senior Counsel, ESG and SEC Reporting
Company: Intuitive
Location: USA
Posted Apr 30, 2024
Intuitive is a company dedicated to minimally invasive care, with a mission to expand physicians' capabilities through innovative technology. They value diversity and inclusion, fostering an environment where team members can thrive and contribute to solving healthcare challenges. The company is seeking a Senior Counsel to provide legal advice on ESG and SEC reporting initiatives, collaborating with various departments and supporting the Board of Directors. The ideal candidate will have extensive legal and compliance experience, strong knowledge of environmental laws, and familiarity with voluntary reporting frameworks. They should possess excellent communication skills, strategic thinking, and the ability to manage multiple tasks in a dynamic environment.
Director - Corporate FP&A
Company: Icertis
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> With unmatched technology and categorydefining innovation Icertis pushes the boundaries of whats possible with contract lifecycle management CLM The AIpowered analystvalidated Icertis Contract Intelligence ICI platform turns contracts from static documents into strategic advantage by structuring and connecting the critical contract information that defines how an organization runs Today the worlds most iconic brands and disruptive innovators trust Icertis to fully realize the intent of their combined 10 million contracts worth more than $1 trillion in 40+ languages and 93 countries <p> <p> <p> <p> <strong> Who we are <strong> Icertis is the only contract intelligence platform companies trust to keep them out in front now and in the future Our unwavering commitment to contract intelligence is grounded in our FORTE valuesFairness Openness Respect Teamwork and Executionwhich guide all our interactions with employees customers partners and stakeholders Because in our mission to be the contract intelligence platform of the world we believe how we get there is as important as the destination <p> <p> <p> <p> As the Director of FPampA you will play a critical leadership role you will work closely with all of companys functional leaders and bring key market strategic and operational insights that will shape the direction of the company and accelerate its growth You will also play a key role in telling the companys financial story to investors <p> <p> <p> <p> The ideal candidate will have a proven trackrecord of driving business outcomes through keen financial insight and business modeling They will have the ability to create a 360degree financial picture of the business that reflects and influences the companys strategy and be excellent at communicating with senior leaders and executives They will be toolsavvy with experience in creating scalable data and reporting solutions that support a datadriven culture LIRS1 <p> <p> <p> <p> <p> <p> <strong> What you will do <strong> <p> <ul> <li> <p> Formulate a robust 360degree financial picture of the business complete with market insights and operational drivers <p> <li> <li> <p> Develop and maintain the 3year Strategic Planning Model and forecast <p> <li> <li> <p> Deliver Global PampL and cash flow forecasts <p> <li> <li> <p> Drive Annual Planning Process work cross functionally to build and maintain the Annual Financial Plan and Departmental Budgets <p> <li> <li> <p> Build and deliver Business Performance ReportingOperating dashboards <p> <li> <li> <p> Perform strategic business analysis as needed MampA Geo Expansion <p> <li> <li> <p> Prepare financial analyses as needed to help drive improvements in the business Current focus areas include market expansion opportunities competitive benchmarking analyses pricing and strategic financial optimization strategies <p> <li> <li> <p> Partner with Controller to enhance and accelerate the financial reporting process <p> <li> <li> <p> Identifies and implements system and process improvements to increase the efficiency and effectiveness of planning and reporting workflows <p> <li> <li> <p> Prepare communications to Board of Directors <p> <li> <li> <p> Drive investor presentations and supporting analysis <p> <li> <li> <p> Develop a deep understanding of the business metrics with an eye towards understanding the benefits and risks from a financial perspective and helping to manage key business drivers and desired outcomes <p> <li> <li> <p> Play a key role in preparation of critical public financial documents to support the IPO process including working with bankers and supporting the production of investor materials and SEC filings eg S1 <p> <li> <ul> <p> <p> <p> <strong> What you will bring <strong> <p> <ul> <li> <p> 12+ years of experience of working in direct strategic analysis support of all aspects of the business at all areas of the PampL <p> <li> <li> <p> MBACPA or equivalent experience preferred <p> <li> <li> <p> Demonstrated complex modeling experience this is a handson role and managers are expected to directly contribute and lead by example <p> <li> <li> <p> Highly analytical detailoriented with a commitment to creating a highquality product Naturally inquisitive and able to extract information from various sources to identify and understand the underlying issue Not afraid to question results <p> <li> <li> <p> Prior success working in a fastpaced entrepreneurial environment takes initiative and works independently <p> <li> <li> <p> Working knowledge of accounting principles required including revenue recognition amortization and accrual vs cash accounting Must have a general understanding of financial statements <p> <li> <li> <p> Must have exceptional written visual and spoken communication skills <p> <li> <li> <p> Experience in preparing and delivering executive board and investor level communications <p> <li> <li> <p> IPO experience is a plus <p> <li> <li> <p> Must have advanced Excel Netsuite and Powerpoint skills <p> <li> <li> <p> Experience implementing financial analysis and planning tools required <p> <li> <ul> <p> <p> <p> <p> <p> $146000 $219000 a year <p> <p> <em> Pay offered will vary based on jobrelated factors such as location experience training skills and abilities In addition to the base salary and annual bonus target and an equity component is included in the compensation package <em> <p> <p> <strong> What we offer <strong> <p> <p> We are committed to the health and wellbeing of all Icertians their families the communities they live in and our customers This commitment is represented in the Icertis Four Rings of Responsibility Take Care of Self Take Care of Family Take Care of Community and Take Care of Business in that order <p> <p> <p> <p> To support these commitments Icertis offers excellent health and welfare benefits a generous 401k match and a robust paid time off program Here are some of the other reasons <a class=fontbold underline fontbold underline postingslink href=httpswwwicertiscomcompanynewsicertisplacesfirstinwashingtons100bestcompaniestoworkfor rel=noopener noreferrer nofollow target=blank> Icertis Places First in Washingtons 100 Best Companies to Work For | Icertis <a> <p> <p> <p> <p> ● Equity RSUs and shared ownership in the company <p> <p> ● Flexible work environment <p> <p> ● Paid maternity and paternity leave <p> <p> ● 7 Days for Humanity 7 paid volunteer days <p> <p> ● Generous holidays including the 4th of July week off paid <p> <p> ● Free professional and leadership coaching <p> <p> ● Annual personal development allowance <p> <p> <p> <p> Icertis Inc provides Equal Employment Opportunity to all employees and applicants for employment without regard to race color religion gender identity or expression sex sexual orientation national origin age disability genetic information marital status amnesty or status as a covered veteran in accordance with applicable federal state and local laws Icertis Inc complies with applicable state and local laws governing nondiscrimination in employment in every location in which the company has facilities If you are in need of accommodation or special assistance to navigate our website or to complete your application please send an email with your request to <a class=fontbold underline fontbold underline postingslink href=mailtocareersicertiscom rel=noopener noreferrer nofollow target=blank> careersicertiscom <a> or get in touch with your recruiter <p> <p> <p> <p> By submitting your application you acknowledge that you have read Icertiss Privacy Policy <a class=fontbold underline fontbold underline postingslink href=httpswwwicertiscomprivacystatement rel=noopener noreferrer nofollow target=blank> httpswwwicertiscomprivacystatement <a> <p> <p> <p> <p> Icertis is not open to third party solicitation or resumes for our posted FTE positions Resumes received from third party agencies that are unsolicited will be considered complimentary <p><p>
Chief Information Security Officer
Company: Grafana Labs
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> <strong> About the role <strong> <p> <p> We are looking for a Chief Information Security Officer to lead our Security team reporting to the CTO You will be responsible for developing and implementing security strategies across the Security Engineering Assurance and Security Operations teams as well as liaising with other teams delivering parts of our overall security posture The ideal candidate will have a proven track record of building andor implementing and improving the maturity of security programs in Cloudbased SaaS organizations and possess excellent leadership and communication skills You must have significant engineering acumen as this is a highly technologydriven role <p> <p> Grafana and the LGTM stack continue to be highly successful open source projects and onpremise products with over a million instances of our application running in the wild Grafana is also the main frontend for Grafana Cloud where users can visualize their telemetry data as well as use our opinionated solutions for easier troubleshooting of both their infrastructure and their applications <p> <p> <strong> Responsibilities <strong> <p> <ul> <li> <p> Define and optimize the security strategy in concert with your leadership team ICs and stakeholders across the business <p> <li> <li> <p> Work with customers and prospects to address security concerns Supporting GTM where significant deals require input from the CISO to close <p> <li> <li> <p> Regular 11s coaching and mentoring to ensure your team members are motivated happy and engaged Providing continuous feedback to ensure that they can add value while maintaining high standards <p> <li> <li> <p> Collaborating with our Engineering Leaders and other organization stakeholders to help define and influence wider product strategy roadmaps and designs <p> <li> <li> <p> Lead effective risk management and compliance programs <p> <li> <li> <p> Be actively engaged with significant incidents including preparation simulation response and affected customer notification and communications <p> <li> <li> <p> Maintain executive board and investor relations with regard to security <p> <li> <ul> <p> <strong> Requirements <strong> <p> <ul> <li> <p> You have previous experience as a CISO or CSO at a B2B cloudbased SaaS company IPO experience is a plus <p> <li> <li> <p> While the core focus of the role is on leadership strategy and executive communications you should have enough technical skillsunderstanding of our stack to manage and challenge a highly technical team and help them arrive at strong decisions <p> <li> <li> <p> You approach security with a DevOps mindset You prefer security by enablement automation and guardrails over gates and roadblocks <p> <li> <li> <p> You have familiarity with securing and operating on public Cloud AWS GCP Azure providers with Kubernetes and with securing combined opensource software OSS and SaaS products <p> <li> <li> <p> You will be comfortable working with engineering teams who have a strong sense of autonomy in their decisionmaking be it technical or productfocused <p> <li> <li> <p> You possess domain knowledge of common information security business continuity and privacy management frameworks regulatory requirements and applicable standards such as ISO 27001 SOC 2 HIPAA GDPR PCI FedRamp SOX etc You have experience maintaining these standards while maintaining operational efficiency <p> <li> <li> <p> You are an excellent written and verbal communicator You can articulate complex cybersecurity concepts to both technical and nontechnical audiences You are adept as translating security problems to business impact <p> <li> <ul> <p> <strong> Bonus Points <strong> <p> <ul> <li> <p> A technical background ideally as a software engineer before transitioning into security amp leadership <p> <li> <li> <p> Experience with highly regulated industries such as healthcare the US government and publicly listed companies <p> <li> <li> <p> Working knowledge of Grafana Labs OSS projects and products Experience in using observability tooling to solve security problems <p> <li> <li> <p> Experience working with OSS communities <p> <li> <li> <p> Experience securing large scale distributed systems <p> <li> <ul> <p> In the USA the Base compensation range for this role is $223600 $267000 Actual compensation may vary based on level experience and skillset as assessed in the interview process Benefits include equity bonus if applicable and other benefits listed <a class=fontbold underline fontbold underline fontbold underline href=httpsgrafanacomaboutcareersjobs rel=noopener noreferrer nofollow target=blank> here <a> <p> <p> <em> Compensation ranges are country specific If you are applying for this role from a different location than listed above your recruiter will discuss your specific markets defined pay range amp benefits at the beginning of the process <em> <p><p>
Customer Support Representative
Company: VETRO FiberMap
Location: USA
Posted Apr 29, 2024
VETRO FiberMap, a high-growth SaaS company based in Portland, Maine, is seeking a Customer Support Representative. The role involves supporting smooth adoption of a mapping software platform used by broadband providers. The ideal candidate should be passionate about helping customers and colleagues, enjoy solving complex data and technical problems, and have a minimum of 2-3 years of relevant work experience. The position offers full benefits, a starting salary of $60,000, and is a remote-first opportunity.
Manager - Customer Success
Company: Flock Safety
Location: USA
Posted Apr 29, 2024
<p class=jobDescription> <h2> <strong> Who is Flock <strong> <h2> <p> Flock Safety is an allinone technology solution to eliminate crime and keep communities safe Our intelligent platform combines the power of communities at scale including cities businesses schools and law enforcement agencies to shape a safer future together Our fullservice maintenancefree technology solution is trusted by communities across the country to help solve and deter crime in the pursuit of safer communities for everyone <p> <p> Our holistic public safety platform is comprehensive and intelligent providing the actionable evidence needed to solve deter and reduce crime across neighborhoods schools businesses and entire cities Without compromising transparency or privacy we are turning unbiased data into objective answers <p> <p> Flock strives to offer a careerdefining experience where you can also make an impact on your community While safety is a serious business we are a supportive team that is optimizing the remote experience to create strong and fulfilling relationships even when we are physically apart Our group of hardworking employees thrive in a positive and inclusive environment where a bias towards action is rewarded <p> <p> We have raised over $380M in venture capital from investors including Tiger Global Andreessen Horowitz Matrix Partners Meritech Capital Partners and Initialized Capital Now surpassing a $3B valuation Flock is scaling intentionally and seeking the best and brightest to help us meet our goal of reducing crime in the United States by 25 in the next three years <p> <p> <strong> The Opportunity <strong> <p> <p> Flock Safety is looking for a Manager of Customer Success to lead and coach a team of CSMs to deliver value and an exceptional experience to our law enforcement customers <p> <p> This is a fully remote position with expectations that this individual will travel on site to customers and their team as necessary This role will require exemplary leadership skills the ability to manage multiple projects at once critical thinking starttofinish ownership a passion for building strong relationships a desire to coach CSMs and effective communication throughout every interaction <p> <p> <strong> The Skillset <strong> <p> <ul> <li> <p> 3+ years experience leading customer facing teams preferably customer success in a SaaS environment <p> <li> <li> <p> Proven ability to build and manage relationships internally and externally preferably in a SaaS environment <p> <li> <li> <p> Comfortable with deescalation management and navigating tough conversations with a solutionsoriented mindset <p> <li> <li> <p> Highly adaptable individual who embraces change and knows how to pivot when confronted with new challenges <p> <li> <li> <p> Can deliver honest and productive feedback to individuals on their team <p> <li> <li> <p> Communicates clearly and concisely about both technical and nontechnical subject matter <p> <li> <li> <p> Diplomatic tactful and poised under pressure with a high comfort with ambiguity <p> <li> <li> <p> Demonstrate strong followthrough and ability to selfmanage multiple tasks and projects at once <p> <li> <li> <p> Passionate about Customer Success the people the relationships and the interactions that drive mutually beneficial results <p> <li> <li> <p> Team player that contributes positively to overall team morale and company culture <p> <li> <li> <p> Willingness to travel <p> <li> <li> <p> Experience using Gainsight or another CS platform preferred <p> <li> <ul> <p> <em> Feeling uneasy that you havent ticked every box Thats okay weve felt that way too Studies have shown women and minorities are less likely to apply unless they meet all qualifications We encourage you to break the status quo and apply to roles that would make you excited to come to work every day <em> <p> <p> <strong> 90 Days at Flock <strong> <p> <p> We are a resultsoriented culture and believe job descriptions are a thing of the past We prescribe to 90 day plans and believe that good days lead to good weeks which lead to good months This serves as a preview of the 90 day plan you will receive if you were to be hired as a Manager Customer Success at Flock Safety <p> <p> <strong> The First 30 Days <strong> <p> <ul> <li> <p> Get to know the product <p> <li> <li> <p> Build relationships and trust with your team 812 CSM <p> <li> <li> <p> Attend CSM Calls dive into Gainsight review OKRs and meet with all direct reports <p> <li> <li> <p> Deepen your understanding of the sales process and our customers by listening to call recordings across the buyers journey in each segment <p> <li> <li> <p> By the end of the 30 days start a meeting operating rhythm with your team and crossfunctional partners 11s team meetings other <p> <li> <ul> <p> <strong> The First 60 Days <strong> <p> <ul> <li> <p> Continue getting to know the customer <p> <li> <li> <p> Create a coaching frame work <p> <li> <li> <p> Establish a project plan <p> <li> <li> <p> Start work tracking in order to help your team achieve their goals <p> <li> <ul> <p> <strong> 90 Days amp Beyond <strong> <p> <ul> <li> <p> Coach the team to drive Net Revenue Retention through proactive and strategic engagementexpansion efforts <p> <li> <li> <p> Ensure communication and collaboration with leaders across the business to achieve the most value possible for our customers <p> <li> <li> <p> Create processes and systems to drive raving promoters we have a product that our customers truly love its your opportunity to ensure our largest customers are seeing value from it <p> <li> <ul> <p> <strong> The Interview Process <strong> <p> <p> We want our interview process to be a true reflection of our culture transparent and collaborative Throughout the interview process your recruiter will guide you through the next steps and ensure you feel prepared every step of the way <p> <ul> <li> <p> Our First Chat During this first conversation youll meet with a recruiter to chat through your background what you could bring to Flock what you are looking for in your next role and who we are <p> <li> <li> <p> The Hiring Manager Interview You will meet with your potential future boss to really dive into the role the team expectations and what success means at Flock This is your chance to really nerd out with someone in your field <p> <li> <li> <p> The Panel Learn more about the team responsibilities and workflows You should be prepared to speak about past projects how you collaborate and communicate with others and how you live our values Depending on the team and role you are interviewing for you may meet with several teammates as well as crossfunctional partners <p> <li> <li> <p> The Technical Assessment Our technical assessments seek to test the hard skills required to do the job Engineers may find themselves in coding interviews or architecture discussions sales roles may present mock discovery calls and leadership roles may craft 90 day plans Your recruiter will inform you of which assessment you will be assigned and ensure you are fully prepared for your big day <p> <li> <li> <p> The Executive Review A chance to meet an executive and view Flock from a different lens Be prepared to ask wellthoughtout questions about the company culture and more <p> <li> <ul> <p> <strong> The Perks <strong> <p> <p> <strong> 💰Salary amp Equity In this role youll receive a starting salary of $11500000$145000K as well as stock options <strong> <p> <p> 🌴 <strong> Use what you need PTO <strong> We seriously mean it plus 11 company holidays and your birthday off <p> <p> ⚕️ <strong> Fullypaid <strong> <a class=fontbold underline fontbold underline fontbold underline href=httpsdrivegooglecomfiled1W8ofLMVCOWL9pYFAVSMsSTaJAA9VmJview rel=noopener noreferrer nofollow target=blank> <strong> health benefits <strong> <a> <strong> plan for employees <strong> including Medical Dental and Vision and an HSA match <p> <p> 👪 <strong> Family Leave <strong> All employees receive 12 weeks of 100 paid parental leave Birthing parents are eligible for an additional 68 weeks of physical recovery time <p> <p> 🍼 <strong> Fertility amp Family Benefits <strong> We have partnered with <a class=fontbold underline fontbold underline fontbold underline href=httpswwwmavencliniccom rel=noopener noreferrer nofollow target=blank> Maven <a> a complete digital health benefit for starting and raising a family We will reimburse $10000 a year for adoption surrogacy or fertility <p> <p> 🧠 <strong> Mental Health <strong> All employees receive an annual subscription to <a class=fontbold underline fontbold underline fontbold underline href=httpswwwheadspacecom rel=noopener noreferrer nofollow target=blank> Headspace <a> <p> <p> 💖 <strong> Caregiver Support <strong> We have partnered with <a class=fontbold underline fontbold underline fontbold underline href=httpswwwcariloopcom rel=noopener noreferrer nofollow target=blank> Cariloop <a> to provide our employees with caregiver support <p> <p> 💸 <strong> Carta Tax Advisor <strong> Employees receive 11 sessions with Equity Tax Advisors who can address individual grants model tax scenarios and answer general questions <p> <p> <strong> 💻WFH Stipend <strong> $150 per month to cover the costs of working from home <p> <p> <strong> 📚Productivity Stipend <strong> $250 per year to use on Audible Calm Masterclass Duolingo Grammarly and so much more <p> <p> <strong> 🏠Home Office Stipend <strong> A onetime $750 to help you create your dream office <p> <p> <strong> 🏢Coworking Space <strong> If youre not local to our ATL HQ well provide $250 a month to get you set up with an All Access Membership to WeWork or a local coworking space in your area <p> <p> 🐾 <strong> Pet Insurance <strong> Weve partnered with <a class=fontbold underline fontbold underline fontbold underline href=httpshellopumpkincarecomparesemutmsource=googleamputmmedium=cpcamputmcampaign=GoogleUSASearchBrandamputmcontent=GoogleUSASearchBrandGeneralExactamputmcampaignid=15710600630amputmadgroupid=131181652986amputmadid=571944109837amputmkeyword=pumpkin20pet20insuranceamputmmatchtype=eampgclid=Cj0KCQiA1sucBhDgARIsAFoytUuUlyKvQJvyvkLRt5ii432apq7ng3BLv0vyiWHFdaawRznFrsMckaAvI5EALwwcB rel=noopener noreferrer nofollow target=blank> Pumpkin <a> to provide insurance for our employees fur babies <p> <p> <em> Flock is an equal opportunity employer We celebrate diverse backgrounds and thoughts and welcome everyone to apply for employment with us We are committed to fostering an environment that is inclusive transparent and collaborative Mutual respect is central to how Flock operates and we believe the best solutions come from diverse perspectives experiences and skills We embrace our differences and know that we are stronger working together <em> <p> <p> <em> If you need assistance or an accommodation due to a disability please email us at careersflocksafetycom This information will be treated as confidential and used only to determine an appropriate accommodation for the interview process <em> <p><p>
Senior Software Engineer - Invoices
Company: Mercury
Location: USA
Posted Apr 29, 2024
<p class=jobDescription> <p> Since the dawn of aviation pilots have faced the constant challenge of air resistance much like sailors navigating the friction of water Amidst this relentless struggle the <em> trim tab <em> emerges as an ingenious yet understated marvel Just as the wheel revolutionized transportation by easing movement over land the <em> trim tab <em> simplifies flight allowing for smoother navigation through the skies It embodies the elegance of simplicity in engineering transforming the demanding task of controlling an aircraft into a more graceful and manageable endeavor <p> <p> At Mercury we are committed to crafting an exceptional banking experience for startups Our team is passionately focused on ensuring our product not only meets but anticipates the needs of our customers <p> <p> The invoicing team is a new initiative at Mercury building a new product vertical on top of our banking foundations Were a team of pragmatic fullstack engineers motivated by the desire to create a lovable product that rescues our customers from frustrating expensive legacy invoicing tools <p> <p> <strong> As part of this role you will <strong> <p> <ul> <li> <p> Help create Mercurys second act the financial system to power startups <p> <li> <li> <p> Join a smallbutmighty team of experienced full stack product engineers creating Mercurys brand new invoicing product <p> <li> <li> <p> Feel a strong sense of product ownership and actively seek responsibility we often selforganize on smallmedium projects and we want someone whos excited to help shape and build Mercurys future <p> <li> <li> <p> Work closely with designers and product leaders to ship lovable experiences We want to transcend the status quo for banking and fintech software and many of our customers are startups and appreciate our slick magical designs <p> <li> <ul> <p> <strong> The ideal candidate for the role <strong> <p> <ul> <li> <p> Has at least 4 years of backend frontend or fullstack development experience with excitement to learn and work with Haskell React and TypeScript <p> <li> <li> <p> Is passionately product minded and has experience building and shipping new products <p> <li> <li> <p> Empathizes with users and can channel their perspective to build lovable products <p> <li> <li> <p> Can balance tradeoffs and find creative solutions to accomplish goals <p> <li> <li> <p> Communicates and collaborates effectively with peers and cross functional counterparts <p> <li> <ul> <p> If this role interests you we invite you to explore our public demo at <a class=fontbold underline fontbold underline fontbold underline href=httpsdemomercurycom rel=noopener noreferrer nofollow target=blank> demomercurycom <a> <p> <p> The total rewards package at Mercury includes base salary equity stock options and benefits Our salary and equity ranges are highly competitive within the SaaS and fintech industry and are updated regularly using the most reliable compensation survey data for our industry New hire offers are made based on a candidates experience expertise geographic location and internal pay equity relative to peers <p> <p> Our target new hire base salary ranges for this role are the following <p> <ul> <li> <p> US employees any location $203100 $238900 <p> <li> <li> <p> Canadian employees any location CAD $184800 $217400 <p> <li> <ul> <p> <em> Mercury is a financial technology company not a bank Banking services provided by Choice Financial Group and Evolve Bank amp Trust Members FDIC <em> <p> <p> <p> <p> LIDNI <p><p>
Backend Engineer
Company: Trufflesecurity
Location: USA
Posted Apr 30, 2024
Truffle Security Co is seeking a passionate Software Engineer with experience in Go, gRPC, and K8s to contribute to their core product features. The role involves backend development, gRPC clients and servers, and continuous learning. The company offers a competitive compensation package, flexible paid time off, and a commitment to building a culture of mentorship, equity, and psychological safety. They are looking for individuals who are passionate about open source, security, and building an enjoyable UX.
Governance Development
Company: Gauntlet
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> Gauntlet leads the field in quantitative research and optimization of DeFi economics We manage market risk optimize growth and ensure economic safety for protocols facilitating the majority of spot trading borrowing and lending activity across all of DeFi protecting and optimizing the largest protocols and networks in the industry As of January 2024 Gauntlet manages risk and incentives covering over $13 billion in customer TVL <p> <p> <p> <p> Gauntlet continually publishes cuttingedge research that informs our risk models alerts and analysis and is among the most cited institution including academic institutions in terms of peerreviewed papers addressing DeFi as a subject Were a Series B company with around 60 employees operating remotefirst with a home base in New York City <p> <p> <p> <p> Gauntlets mission is to <strong> drive adoption and understanding in the financial systems of the future <strong> Building with decentralized systems creates novel challenges for mechanism designers smart contract developers and endusers of financial products which are not seen in traditional software development and investing contexts Gauntlet is dedicated to enhancing our industrys understanding of this new domain and revealing how to safely navigate the true bleeding edge of 21st century financial innovation <p> <p> <p> <p> Our extremely passionate team works tirelessly to bridge the gap for datadriven insights and analytical research in collateralized blockchain protocols We strive to maintain an atmosphere that fosters innovation and new ideas through collaboration research and deep discussion to meet our customers needs to grow and manage incentives better <p> <p> <p> <p> In order to grow our impact in the DeFi space we are looking to hire an experienced cryptonative Governance actor to support Gauntlets increasing delegate activities This role will be an active participant in the DAOs where Gauntlet is a delegate ongoing forum participation maintaining exemplary voting and communication rates and joining delegate calls or other DAOrelated events among other things This role will also actively seek out opportunities for new delegation and proactively identify potential revenue opportunities that align with Gauntlets business <p> <p> <p> <p> <p> <p> <strong> Responsibilities <strong> <p> <ul> <li> <p> Develop an intricate understanding of the DAOs where Gauntlet is or becomes a delegate <p> <li> <li> <p> Active forum participation commenting on proposals and other DAOwide conversations <p> <li> <li> <p> Internal collaboration around decisionmaking for on and offchain votes <p> <li> <li> <p> Ensure Gauntlet maintains a 100 voting and participation rate <p> <li> <li> <p> Proactively identify revenue opportunities that identify with Gauntlets product suite <p> <li> <li> <p> Actively seek increased and net new delegation <p> <li> <li> <p> Maintain active reporting on decidedupon metrics for internal tracking <p> <li> <li> <p> Work crossfunctionally as needed with Data Science Product and Engineering <p> <li> <li> <p> Maintain a pulse and viewpoint on emerging trends in DeFi and adjacent industries <p> <li> <ul> <p> <p> <p> <strong> Qualifications <strong> <p> <ul> <li> <p> Demonstrated DeFi native governanceDAO experience <p> <li> <li> <p> Deep understanding of the DeFi landscape and emerging trends <p> <li> <li> <p> Comfortable working crossfunctionally with Product Engineering Data Science and Finance teams to ensure successful outcomes <p> <li> <li> <p> Excellent verbal and written communication skills <p> <li> <li> <p> Exceptional attention to detail and ability to prioritize <p> <li> <li> <p> Ability to operate autonomously and across multiple time zones <p> <li> <li> <p> You have an analytical background <p> <li> <ul> <p> <p> <p> <strong> Bonus Points <strong> <p> <ul> <li> <p> You have a cryptonative network <p> <li> <li> <p> Youve served as a delegate in a large DAO participated in a blockchain club or professional delegate <p> <li> <li> <p> Youve served as a governance lead for your organization in a bluechip protocol <p> <li> <li> <p> Youve held positions on grants councils or similar <p> <li> <li> <p> You have a technical or mathematical background and are able to disseminate technical topics to nontechnical audiences <p> <li> <ul> <p> <p> <p> <strong> Benefits and Perks <strong> <p> <ul> <li> <p> Remote first work from anywhere in the US amp CAN <p> <li> <li> <p> Regular inperson company retreats and crosscountry office visit perk <p> <li> <li> <p> 100 paid medical dental and vision premiums for employees <p> <li> <li> <p> Laptop monitor keyboard and mouse setup provided <p> <li> <li> <p> $1000 WFH stipend <p> <li> <li> <p> Monthly reimbursement for home internet phone and cellular data <p> <li> <li> <p> Unlimited vacation <p> <li> <li> <p> 100 paid parental leave of 12 weeks <p> <li> <li> <p> Fertility benefits <p> <li> <li> <p> Opportunity for incentive compensation <p> <li> <ul> <p> <p> <p> <p> <p> <strong> Please note at this time our hiring is reserved for potential employees who are able to work within the contiguous United States and Canada Should you need alternative accommodations please note that in your application <strong> <p> <p> <p> <p> <em> The national pay range for this role is $120000 base plus additional On Target Earnings potential by level and equity in the company Our salary ranges are based on paying competitively for a company of our size and industry and are one part of many compensation benefits and other reward opportunities we provide Individual pay rate decisions are based on a number of factors including qualifications for the role experience level skill set and balancing internal equity relative to peers at the company <em> <p> <p> <p> <p> LIRemote <p><p>
Accounting Manager
Company: Eargo
Location: USA
Posted Apr 29, 2024
<p class=jobDescription> <p> Were Eargo and were on a mission to disrupt innovate and reimage the hearing industry If you believe fun at work is nonnegotiable and want to experience the joy of being a part of helping someone hear life to the fullest again expect tears of joy then this is the place for you Our passionate fastpaced energetic team is driven by the belief that people shouldnt feel like they need a hearing aidthey should want one So if working with some of the coolest most talented folks around and making an impact every single day sounds like a dream gig then we want to hear from you <p> <p> <p> <p> The Accounting Manager is an active engaged member of the Companys Finance and Accounting team reporting directly to the Senior Manager Accounting The Accounting Manager supports accurate and timely financial reports and statements and ensures adherence to appropriate internal control procedures The Accounting Manager exhibits the highest professional standards ethical principles in addition to other valued attributes including attention to details a strong work ethic and the capacity to work independently with a sense of urgency and commitment <p> <p> <p> <p> <p> <p> <strong> Essential Job Duties and Responsibilities <strong> <p> <ul> <li> <p> Responsible for helping manage the daily activities of Eargos accounting and financial operations <p> <li> <li> <p> Supervise train and develop direct reports <p> <li> <li> <p> Primary focus areas will include accounts payable expense accruals payroll transactions allocations fixed assets capitalized software intercompany transactions and the monthlyquarterlyyearend Close process <p> <li> <li> <p> Follow company guidelines for supporting documentation determining proper coding and routing through approval matrix <p> <li> <li> <p> Handle vendor additions maintenance including W9 tracking and year end 1099 reporting <p> <li> <li> <p> Process companys payables including vendor invoices credit memos employee expense reports and manual check requests <p> <li> <li> <p> Responsible for helping manage the preparation of monthly journal entries and related general ledger account reconciliations <p> <li> <li> <p> Assist in preparation and timely filingpayment of sales personal property taxes franchise federal and state taxes <p> <li> <li> <p> Assist in preparation and timely filing of annual SOS filings in various states <p> <li> <li> <p> Assist in the preparation of financial statements in accordance with US GAAP <p> <li> <li> <p> Assist in maintaining and enhancing internal controls policies and procedures and the related documentation and recordkeeping compliance <p> <li> <li> <p> Assist with yearend audit and quarterly review of financial statements and related controls over financial reporting <p> <li> <li> <p> Support budget and forecasting activities as required <p> <li> <li> <p> Provide responses and support for inbound departmental inquiries and adhoc analysis <p> <li> <li> <p> Support internal and external audit requirements <p> <li> <li> <p> Support accounting teams commitment to timely and accurate processing of accounting transactions in accordance with US GAAP and the Companys internal controls <p> <li> <li> <p> Proactively identify issues and implement process improvements to streamline processes <p> <li> <ul> <p> <p> <p> <strong> Requirements <strong> <p> <ul> <li> <p> Degree in Accounting or Finance <p> <li> <li> <p> 7+ years of relevant accounting experience with increasing responsibility preferably at a rapidly growing technology including medical technology company <p> <li> <li> <p> Public accounting or audit experience preferred but not required <p> <li> <li> <p> Experience with key accounting operations including general ledger transactions OrderToCash ProcureToPay Payroll Fixed Assets etc <p> <li> <li> <p> Meticulous attention to detail with an analytical mind and excellent math skills <p> <li> <li> <p> Sound understanding of GAAP amp SOX requirements related to AP <p> <li> <li> <p> Strong communication skills written and oralStrong knowledge of accounting <p> <li> <li> <p> CPA a plus but not required <p> <li> <li> <p> Strong Excel skills required <p> <li> <li> <p> Experience with NetSuite or similar ERP system Expensify and Billcom <p> <li> <li> <p> Strong work ethic capacity to get things done independently and consistent performance with a sense of urgency and commitment <p> <li> <ul> <p> <p> <p> <p> <p> $100000 $125000 a year <p> <p> The annual base salary range for this position based in the United States is listed above This salary range is an estimate and the actual salary may vary based on Eargos compensation practices job related skills depth of experience relevant certifications and trainings in addition to <strong> geographic location <strong> Based on the factors above Eargo utilizes the full width of the range <p> <p> <strong> Not accepting third party agency submissions for this role <strong> <p> <p> <p> <p> <p> <p> <em> Eargo is an equal opportunity employer that is committed to hiring a diverse workforce We welcome all applicants and employees without regard to race color religion sex pregnancy sexual orientation gender identity national origin age protected veteran status or disability status We value unique contributions and openly welcome individuals of all perspectives experience and backgrounds to apply <em> <p><p>
Director - Data & AI
Company: TTEC Digital
Location: USA
Posted Apr 29, 2024
<p class=jobDescription> <p> At TTEC Digital we coach clients to ensure their employees feel valued and fully supported because an amazing customer experience is an employee first process Our vision is the same a place where employees know they can thrive <p> <p> <p> <p> The Analytics Practice relies on Data Science Data Engineering and Marketing Analytic team members to equip our clients with the leading tools and datadriven insights needed to personalize and fuel exceptional experiences CX for their customers <p> <p> <p> <p> As the Director Data amp AI working remotely in the US or in a hybrid capacity in the Boston area you will serve as senior subject matter expert in the data amp analytics space for clients with the aim of crafting customer value maximizing growth or improving the business performance of our clients The Director Data amp AI role is a highly visible and strategic position where you will have the opportunity to develop a compelling vision for bringing actionable AIML solutions to our clients and advancing their digital transformations <p> <p> <p> <p> <p> <p> <strong> What youll be doing <strong> <p> <ul> <li> <p> Serve as senior subject matter expert in the data amp analytics space for clients with the aim of crafting customer value maximizing growth or improving the business performance of our clients <p> <li> <li> <p> Advise and partner with clients to solve their business problems with cloudbased modern data architectures and advanced analytics <p> <li> <li> <p> Develop a compelling vision for bringing actionable AIML solutions to our clients and advancing their digital transformations <p> <li> <li> <p> Develop Data and AI products to advance and enable the key mission outcomes for our clients <p> <li> <li> <p> Work closely with the sales and delivery teams to run presales efforts and engagements <p> <li> <li> <p> Collaborate on business development activities as a domain specialist for the Data and AI team across a variety of clients and industries <p> <li> <li> <p> Drive overall growth of practice through a combination of business development talent management oversight of delivery work and thought leadership <p> <li> <li> <p> Develop proposals presentations statement of work SOW and proactively recommend strategies to grow the data amp analytics practice presence in existing accounts <p> <li> <li> <p> Proactively identify internal and external dependencies issues scope changes and progress against project plan <p> <li> <li> <p> Review select and integrate nextgeneration technologies into the architectural strategy as needed <p> <li> <li> <p> Develop and expand our knowledge base and best practices for delivering data products <p> <li> <li> <p> Perform key leadership and mentorship role in the areas of advanced data techniques including data architecture data integration data governance ML and implementation in cloudbased and hybrid architectures <p> <li> <li> <p> Build and lead highperforming agile teams <p> <li> <li> <p> Devise talent strategy for the team identify resource gaps or inefficiencies build hiring plan recommend promotions and manage performance for consistency with the needs and vision of the department <p> <li> <ul> <p> <p> <p> <strong> What youll bring to us <strong> <p> <ul> <li> <p> Bachelors in Computer Science Engineering or other quantitative field with significant leadership experience <p> <li> <li> <p> 15+ years of demonstrated experience within data amp analytics <p> <li> <li> <p> 5+ years of experience in the consulting industry including technical presales expertise <p> <li> <li> <p> Experience in partner selling pipeline development GoToMarket strategies and management skills with attention to detail <p> <li> <li> <p> Experience leading teams of data engineers data scientists and data storytellers on largescale data projects <p> <li> <li> <p> Experience working on public cloud environments Azure GCP AWS and associated deep understanding of Data and ML tools offered <p> <li> <li> <p> Strong fundaments in data structures algorithms automated testing objectoriented programming performance complexity and implications of architecture on software performance <p> <li> <li> <p> A proven track record of using quantitative analysis to impact key business or product decisions <p> <li> <li> <p> A solid grasp of common statistical applications and methods AB tests and multivariate experiments probabilities regression <p> <li> <li> <p> Understanding of Agile Software Development Lifecycle and project planningexecution skills <p> <li> <li> <p> Desire to thrive in a constantly innovating and changing environment <p> <li> <li> <p> Strong skills in team leadership and networking ability to work across multiple organizations to accomplish diverse goals <p> <li> <li> <p> Exceptional presentation written and verbal communication skills <p> <li> <li> <p> Proven ability to understand the longterm big picture and shortterm perspective of situations <p> <li> <ul> <p> <p> <p> <p> <p> The anticipated range for individuals expressing interest in this position is $ 150K to $200K USD Actual compensation offers to a candidate may vary based on geographic location work experience education andor skill levels This position is eligible to participate in an annual incentive program <p> <p> <p> <p> <strong> Benefits available to eligible employees include <strong> <p> <p> Medical dental and vision <p> <p> Taxadvantaged healthcare accounts <p> <p> Financial and income protection benefits <p> <p> Paid time off PTO and wellness time off <p> <p> <p> <p> LIMS1 <p> <p> <p> <p> <strong> About Us <strong> <p> <p> TTEC Digital and our 1800+ employees pioneer engagement and growth solutions that fuel the exceptional customer experience CX Our sister company TTEC Engage is a 60000+ employee service company with customer service representatives located around the world TTEC Holdings Inc is the parent company for both Digital and Engage When clients have a holistic need they can draw from these independently managed centers of excellence TTEC Digital and TTEC Engage <p> <p> <p> <p> We are also delighted to share that TTEC has been awarded the Great Place To Work 20242025 certification based on outstanding employee experience across 14 countries <p> <p> <p> <p> TTEC is a proud equal opportunity employer where all qualified applicants will receive consideration for employment without regard to age race color religion sex sexual orientation gender identity national origin disability TTEC has fully embraced and is committed to expanding our diverse and inclusive workforce We strive to reflect the communities we serve while delivering amazing service and technology centered around humanity <p> <p> <p> <p> Rarely do applicants meet all desired job qualifications so if you feel you would succeed in the role above please take a moment and share your qualifications <p> <p> <p> <p> <p> <p> LIRemoteUS <p><p>
English Teacher
Company: Enlego
Location: USA
Posted Apr 30, 2024
Enlego offers personalized online English courses taught by native speaking, fluent ESL teachers. The company focuses on developing students' communicative proficiency and employs strict recruitment criteria to ensure quality. Teachers guide students throughout their studies, providing engaging and interactive lessons, and employ communicative teaching techniques tailored to each student's needs.