Public Safety Ensured Jobs in USA
250,501 open positions · Updated daily
Looking for Public Safety Ensured jobs in USA? Browse our curated listings with transparent salary information to find the perfect Public Safety Ensured position in the USA area.
Engineering Manager - Developer Platform
Company: Reddit
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> Reddit has an amazing history of individual and communitydriven innovation With no official support thousands of user scripts selfidentified bots and services run against our API and enrich the experience Redditors have on our platform Furthermore the value of Reddit data has powered the creation and growth of numerous businesses The goal of the Reddit Developer Platform team is to further empower communities to innovate while establishing a significant new business centered on our Data API <p> <p> This role can be remote within the United States or Canada or can be a hybrid model if near an office Offices are located in San Francisco Los Angeles Chicago New York City and Toronto <p> <p> We are looking for an experienced Engineering Manager with a strong technical background to lead reliability for our Data API You will play a pivotal role in not only evolving the existing Data API but also spearheading initiatives to monetize API products effectively This is a unique opportunity to join a key pillar of one of the most important consumer products on the Internet <p> <p> <strong> What Youll Be Doing <strong> <p> <ul> <li> <p> Building data and streaming data products for a variety of external enterprise customers who are looking for realtime access to Reddits content and usage <p> <li> <li> <p> Evolving Reddits public API and capabilities towards a cleaner more elegant Developer Experience <p> <li> <li> <p> Making a platform that is highly available low on latency and at internet scale <p> <li> <li> <p> Laying the technical foundation for future features and experiences such as enterprise search over Reddit data <p> <li> <ul> <p> <strong> What We Expect From You <strong> <p> <ul> <li> <p> 8+ years of industry experience preferably building maintaining and managing platforms and infrastructure <p> <li> <li> <p> 2+ years of experience managing engineering teams <p> <li> <li> <p> 2+ years of experience in a consumer internet data or streaming platform at highscale <p> <li> <li> <p> 2+ years of experience using Kafka Flink or similar streaming data infrastructure <p> <li> <li> <p> Strong experience in architecting and delivering scalable solutions using cloud providers such as AWS GCP Azure and likely Kubernetes <p> <li> <li> <p> Solid understanding of DevOps principles CICD pipelines and infrastructure automation <p> <li> <li> <p> Youre highly technical enough to solve many problems your team has yourself but you prefer to guide your team into solving them <p> <li> <li> <p> Youre highagency selfdirected detailoriented and reliable <p> <li> <ul> <p> <strong> Responsibilities <strong> <p> <ul> <li> <p> Build and manage a team of 78 engineers hiring topnotch individual contributors and giving them room to shine <p> <li> <li> <p> Build and execute a technical roadmap of systems improvements <p> <li> <li> <p> Be the owner and steward of reliability for Reddits Data API product suite <p> <li> <li> <p> Be the crossfunctional face of your team to stakeholders across Product BD and more <p> <li> <ul> <p> <strong> Bonus Points <strong> <p> <ul> <li> <p> Experience in influencing larger organizations on technical directionbest practices <p> <li> <li> <p> Deep technical contributions to open source or published projects <p> <li> <ul> <p> <strong> Benefits <strong> <p> <ul> <li> <p> Comprehensive Healthcare Benefits <p> <li> <li> <p> 401k Matching <p> <li> <li> <p> Workspace benefits for your home office <p> <li> <li> <p> Personal amp Professional development funds <p> <li> <li> <p> Family Planning Support <p> <li> <li> <p> Flexible Vacation please use them amp Reddit Global Wellness Days <p> <li> <li> <p> 4+ months paid Parental Leave <p> <li> <li> <p> Paid Volunteer time off <p> <li> <ul> <p> LIRemote LIJD3 <p><p>
Business Development - B2B
Company: Spruce
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> SpruceID is on a mission to help consumers take control and ownership of their identity and the data that is associated with it SpruceID is building a future where users own their identity and data across all digital interactions Our opensource credentialing infrastructure is standardscompliant productionready and extensible to typical enterprise and government IT systems Were a team of thoughtful nimble experts in opensourced software development user experience and public policy Transparency privacy and interoperability are hallmarks of our work <p> <p> <p> <p> We are hiring a business development wizard to own relationship management across partners and prospects to drive SpruceID business development including both netnew and expansion opportunities They will proactively capitalize on their own and the SpruceID network to target opportunities across private companies large and small including both enterprises and startups to optimize our GTM efforts aligned with product strategy This role will also synthesize market learnings to inform our product development thought leadership and overall brand positioning <p> <p> <p> <p> Applicants to be considered for this role must be based in the United States <p> <p> <p> <p> <p> <p> <strong> Responsibilities <strong> <p> <ul> <li> <p> Craft BD strategies to develop the relying party ecosystem for verifiable digital credentials across industries such as Healthcare Financial Services Payments Education Retail and Telcos <p> <li> <li> <p> Collaborate with SpruceID investor and consultant network to drive BD strategy <p> <li> <li> <p> Manage outreach campaigns and build relationships with relevant audiences <p> <li> <li> <p> Identify and close small quick wins while simultaneously managing extended complex sales cycles <p> <li> <li> <p> Collaborate with Product team to identify and articulate relevant use cases and product pitches <p> <li> <li> <p> Monitors emerging market trends to inform Business Development and Product strategies <p> <li> <li> <p> Drive the full opportunity lifecycle from a relationship management perspective with high accountability <p> <li> <ul> <p> <p> <p> <strong> Qualifications <strong> <p> <ul> <li> <p> Minimum 3 years of demonstrated success in Sales or BD or similar GTM role at a fastgrowing earlystage startup <p> <li> <li> <p> Minimum 5 years of technology full lifecycle prospecting to close Sales or BD experience <p> <li> <li> <p> Experience working in or deeply familiar with one of the following industries Financial Services Payments Healthcare Tech or Retail Tech <p> <li> <li> <p> Expert at communicating new ideas and technical concepts to broad audiences with the ability to tailor explanations to specific groups <p> <li> <li> <p> Familiarity with product management frameworks and effective collaborator with Product teams <p> <li> <li> <p> Fluency in English <p> <li> <ul> <p> <p> <p> <strong> Bonus <strong> <p> <ul> <li> <p> Experience working in the identity verification IDV space <p> <li> <li> <p> Working understanding of the identity industry andor relevant technologies to digital verifiable credentials including ISO mDLs and W3C VCs <p> <li> <ul> <p> <p> <p> <p> <p> We are passionate about cultivating a thriving culture of diverse individuals who bring unique perspectives to our mission We are committed to equal employment opportunity regardless of race color ancestry religion sex national origin sexual orientation age citizenship marital status disability gender identity or Veteran status <p><p>
Senior Counsel, ESG and SEC Reporting
Company: Intuitive
Location: USA
Posted Apr 30, 2024
Intuitive is a company dedicated to minimally invasive care, with a mission to expand physicians' capabilities through innovative technology. They value diversity and inclusion, fostering an environment where team members can thrive and contribute to solving healthcare challenges. The company is seeking a Senior Counsel to provide legal advice on ESG and SEC reporting initiatives, collaborating with various departments and supporting the Board of Directors. The ideal candidate will have extensive legal and compliance experience, strong knowledge of environmental laws, and familiarity with voluntary reporting frameworks. They should possess excellent communication skills, strategic thinking, and the ability to manage multiple tasks in a dynamic environment.
Director - Corporate FP&A
Company: Icertis
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> With unmatched technology and categorydefining innovation Icertis pushes the boundaries of whats possible with contract lifecycle management CLM The AIpowered analystvalidated Icertis Contract Intelligence ICI platform turns contracts from static documents into strategic advantage by structuring and connecting the critical contract information that defines how an organization runs Today the worlds most iconic brands and disruptive innovators trust Icertis to fully realize the intent of their combined 10 million contracts worth more than $1 trillion in 40+ languages and 93 countries <p> <p> <p> <p> <strong> Who we are <strong> Icertis is the only contract intelligence platform companies trust to keep them out in front now and in the future Our unwavering commitment to contract intelligence is grounded in our FORTE valuesFairness Openness Respect Teamwork and Executionwhich guide all our interactions with employees customers partners and stakeholders Because in our mission to be the contract intelligence platform of the world we believe how we get there is as important as the destination <p> <p> <p> <p> As the Director of FPampA you will play a critical leadership role you will work closely with all of companys functional leaders and bring key market strategic and operational insights that will shape the direction of the company and accelerate its growth You will also play a key role in telling the companys financial story to investors <p> <p> <p> <p> The ideal candidate will have a proven trackrecord of driving business outcomes through keen financial insight and business modeling They will have the ability to create a 360degree financial picture of the business that reflects and influences the companys strategy and be excellent at communicating with senior leaders and executives They will be toolsavvy with experience in creating scalable data and reporting solutions that support a datadriven culture LIRS1 <p> <p> <p> <p> <p> <p> <strong> What you will do <strong> <p> <ul> <li> <p> Formulate a robust 360degree financial picture of the business complete with market insights and operational drivers <p> <li> <li> <p> Develop and maintain the 3year Strategic Planning Model and forecast <p> <li> <li> <p> Deliver Global PampL and cash flow forecasts <p> <li> <li> <p> Drive Annual Planning Process work cross functionally to build and maintain the Annual Financial Plan and Departmental Budgets <p> <li> <li> <p> Build and deliver Business Performance ReportingOperating dashboards <p> <li> <li> <p> Perform strategic business analysis as needed MampA Geo Expansion <p> <li> <li> <p> Prepare financial analyses as needed to help drive improvements in the business Current focus areas include market expansion opportunities competitive benchmarking analyses pricing and strategic financial optimization strategies <p> <li> <li> <p> Partner with Controller to enhance and accelerate the financial reporting process <p> <li> <li> <p> Identifies and implements system and process improvements to increase the efficiency and effectiveness of planning and reporting workflows <p> <li> <li> <p> Prepare communications to Board of Directors <p> <li> <li> <p> Drive investor presentations and supporting analysis <p> <li> <li> <p> Develop a deep understanding of the business metrics with an eye towards understanding the benefits and risks from a financial perspective and helping to manage key business drivers and desired outcomes <p> <li> <li> <p> Play a key role in preparation of critical public financial documents to support the IPO process including working with bankers and supporting the production of investor materials and SEC filings eg S1 <p> <li> <ul> <p> <p> <p> <strong> What you will bring <strong> <p> <ul> <li> <p> 12+ years of experience of working in direct strategic analysis support of all aspects of the business at all areas of the PampL <p> <li> <li> <p> MBACPA or equivalent experience preferred <p> <li> <li> <p> Demonstrated complex modeling experience this is a handson role and managers are expected to directly contribute and lead by example <p> <li> <li> <p> Highly analytical detailoriented with a commitment to creating a highquality product Naturally inquisitive and able to extract information from various sources to identify and understand the underlying issue Not afraid to question results <p> <li> <li> <p> Prior success working in a fastpaced entrepreneurial environment takes initiative and works independently <p> <li> <li> <p> Working knowledge of accounting principles required including revenue recognition amortization and accrual vs cash accounting Must have a general understanding of financial statements <p> <li> <li> <p> Must have exceptional written visual and spoken communication skills <p> <li> <li> <p> Experience in preparing and delivering executive board and investor level communications <p> <li> <li> <p> IPO experience is a plus <p> <li> <li> <p> Must have advanced Excel Netsuite and Powerpoint skills <p> <li> <li> <p> Experience implementing financial analysis and planning tools required <p> <li> <ul> <p> <p> <p> <p> <p> $146000 $219000 a year <p> <p> <em> Pay offered will vary based on jobrelated factors such as location experience training skills and abilities In addition to the base salary and annual bonus target and an equity component is included in the compensation package <em> <p> <p> <strong> What we offer <strong> <p> <p> We are committed to the health and wellbeing of all Icertians their families the communities they live in and our customers This commitment is represented in the Icertis Four Rings of Responsibility Take Care of Self Take Care of Family Take Care of Community and Take Care of Business in that order <p> <p> <p> <p> To support these commitments Icertis offers excellent health and welfare benefits a generous 401k match and a robust paid time off program Here are some of the other reasons <a class=fontbold underline fontbold underline postingslink href=httpswwwicertiscomcompanynewsicertisplacesfirstinwashingtons100bestcompaniestoworkfor rel=noopener noreferrer nofollow target=blank> Icertis Places First in Washingtons 100 Best Companies to Work For | Icertis <a> <p> <p> <p> <p> ● Equity RSUs and shared ownership in the company <p> <p> ● Flexible work environment <p> <p> ● Paid maternity and paternity leave <p> <p> ● 7 Days for Humanity 7 paid volunteer days <p> <p> ● Generous holidays including the 4th of July week off paid <p> <p> ● Free professional and leadership coaching <p> <p> ● Annual personal development allowance <p> <p> <p> <p> Icertis Inc provides Equal Employment Opportunity to all employees and applicants for employment without regard to race color religion gender identity or expression sex sexual orientation national origin age disability genetic information marital status amnesty or status as a covered veteran in accordance with applicable federal state and local laws Icertis Inc complies with applicable state and local laws governing nondiscrimination in employment in every location in which the company has facilities If you are in need of accommodation or special assistance to navigate our website or to complete your application please send an email with your request to <a class=fontbold underline fontbold underline postingslink href=mailtocareersicertiscom rel=noopener noreferrer nofollow target=blank> careersicertiscom <a> or get in touch with your recruiter <p> <p> <p> <p> By submitting your application you acknowledge that you have read Icertiss Privacy Policy <a class=fontbold underline fontbold underline postingslink href=httpswwwicertiscomprivacystatement rel=noopener noreferrer nofollow target=blank> httpswwwicertiscomprivacystatement <a> <p> <p> <p> <p> Icertis is not open to third party solicitation or resumes for our posted FTE positions Resumes received from third party agencies that are unsolicited will be considered complimentary <p><p>
Chief Information Security Officer
Company: Grafana Labs
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> <strong> About the role <strong> <p> <p> We are looking for a Chief Information Security Officer to lead our Security team reporting to the CTO You will be responsible for developing and implementing security strategies across the Security Engineering Assurance and Security Operations teams as well as liaising with other teams delivering parts of our overall security posture The ideal candidate will have a proven track record of building andor implementing and improving the maturity of security programs in Cloudbased SaaS organizations and possess excellent leadership and communication skills You must have significant engineering acumen as this is a highly technologydriven role <p> <p> Grafana and the LGTM stack continue to be highly successful open source projects and onpremise products with over a million instances of our application running in the wild Grafana is also the main frontend for Grafana Cloud where users can visualize their telemetry data as well as use our opinionated solutions for easier troubleshooting of both their infrastructure and their applications <p> <p> <strong> Responsibilities <strong> <p> <ul> <li> <p> Define and optimize the security strategy in concert with your leadership team ICs and stakeholders across the business <p> <li> <li> <p> Work with customers and prospects to address security concerns Supporting GTM where significant deals require input from the CISO to close <p> <li> <li> <p> Regular 11s coaching and mentoring to ensure your team members are motivated happy and engaged Providing continuous feedback to ensure that they can add value while maintaining high standards <p> <li> <li> <p> Collaborating with our Engineering Leaders and other organization stakeholders to help define and influence wider product strategy roadmaps and designs <p> <li> <li> <p> Lead effective risk management and compliance programs <p> <li> <li> <p> Be actively engaged with significant incidents including preparation simulation response and affected customer notification and communications <p> <li> <li> <p> Maintain executive board and investor relations with regard to security <p> <li> <ul> <p> <strong> Requirements <strong> <p> <ul> <li> <p> You have previous experience as a CISO or CSO at a B2B cloudbased SaaS company IPO experience is a plus <p> <li> <li> <p> While the core focus of the role is on leadership strategy and executive communications you should have enough technical skillsunderstanding of our stack to manage and challenge a highly technical team and help them arrive at strong decisions <p> <li> <li> <p> You approach security with a DevOps mindset You prefer security by enablement automation and guardrails over gates and roadblocks <p> <li> <li> <p> You have familiarity with securing and operating on public Cloud AWS GCP Azure providers with Kubernetes and with securing combined opensource software OSS and SaaS products <p> <li> <li> <p> You will be comfortable working with engineering teams who have a strong sense of autonomy in their decisionmaking be it technical or productfocused <p> <li> <li> <p> You possess domain knowledge of common information security business continuity and privacy management frameworks regulatory requirements and applicable standards such as ISO 27001 SOC 2 HIPAA GDPR PCI FedRamp SOX etc You have experience maintaining these standards while maintaining operational efficiency <p> <li> <li> <p> You are an excellent written and verbal communicator You can articulate complex cybersecurity concepts to both technical and nontechnical audiences You are adept as translating security problems to business impact <p> <li> <ul> <p> <strong> Bonus Points <strong> <p> <ul> <li> <p> A technical background ideally as a software engineer before transitioning into security amp leadership <p> <li> <li> <p> Experience with highly regulated industries such as healthcare the US government and publicly listed companies <p> <li> <li> <p> Working knowledge of Grafana Labs OSS projects and products Experience in using observability tooling to solve security problems <p> <li> <li> <p> Experience working with OSS communities <p> <li> <li> <p> Experience securing large scale distributed systems <p> <li> <ul> <p> In the USA the Base compensation range for this role is $223600 $267000 Actual compensation may vary based on level experience and skillset as assessed in the interview process Benefits include equity bonus if applicable and other benefits listed <a class=fontbold underline fontbold underline fontbold underline href=httpsgrafanacomaboutcareersjobs rel=noopener noreferrer nofollow target=blank> here <a> <p> <p> <em> Compensation ranges are country specific If you are applying for this role from a different location than listed above your recruiter will discuss your specific markets defined pay range amp benefits at the beginning of the process <em> <p><p>
Engineering Manager, Developer Platform
Company: Reddit
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> Reddit has an amazing history of individual and communitydriven innovation With no official support thousands of user scripts selfidentified bots and services run against our API and enrich the experience Redditors have on our platform Furthermore the value of Reddit data has powered the creation and growth of numerous businesses The goal of the Reddit Developer Platform team is to further empower communities to innovate while establishing a significant new business centered on our Data API <p> <p> This role can be remote within the United States or Canada or can be a hybrid model if near an office Offices are located in San Francisco Los Angeles Chicago New York City and Toronto <p> <p> We are looking for an experienced Engineering Manager with a strong technical background to lead reliability for our Data API You will play a pivotal role in not only evolving the existing Data API but also spearheading initiatives to monetize API products effectively This is a unique opportunity to join a key pillar of one of the most important consumer products on the Internet <p> <p> <strong> What Youll Be Doing <strong> <p> <ul> <li> <p> Building data and streaming data products for a variety of external enterprise customers who are looking for realtime access to Reddits content and usage <p> <li> <li> <p> Evolving Reddits public API and capabilities towards a cleaner more elegant Developer Experience <p> <li> <li> <p> Making a platform that is highly available low on latency and at internet scale <p> <li> <li> <p> Laying the technical foundation for future features and experiences such as enterprise search over Reddit data <p> <li> <ul> <p> <strong> What We Expect From You <strong> <p> <ul> <li> <p> 8+ years of industry experience preferably building maintaining and managing platforms and infrastructure <p> <li> <li> <p> 2+ years of experience managing engineering teams <p> <li> <li> <p> 2+ years of experience in a consumer internet data or streaming platform at highscale <p> <li> <li> <p> 2+ years of experience using Kafka Flink or similar streaming data infrastructure <p> <li> <li> <p> Strong experience in architecting and delivering scalable solutions using cloud providers such as AWS GCP Azure and likely Kubernetes <p> <li> <li> <p> Solid understanding of DevOps principles CICD pipelines and infrastructure automation <p> <li> <li> <p> Youre highly technical enough to solve many problems your team has yourself but you prefer to guide your team into solving them <p> <li> <li> <p> Youre highagency selfdirected detailoriented and reliable <p> <li> <ul> <p> <strong> Responsibilities <strong> <p> <ul> <li> <p> Build and manage a team of 78 engineers hiring topnotch individual contributors and giving them room to shine <p> <li> <li> <p> Build and execute a technical roadmap of systems improvements <p> <li> <li> <p> Be the owner and steward of reliability for Reddits Data API product suite <p> <li> <li> <p> Be the crossfunctional face of your team to stakeholders across Product BD and more <p> <li> <ul> <p> <strong> Bonus Points <strong> <p> <ul> <li> <p> Experience in influencing larger organizations on technical directionbest practices <p> <li> <li> <p> Deep technical contributions to open source or published projects <p> <li> <ul> <p> <strong> Benefits <strong> <p> <ul> <li> <p> Comprehensive Health benefits <p> <li> <li> <p> Retirement Savings plan with matching contributions <p> <li> <li> <p> Workspace benefits for your home office <p> <li> <li> <p> Personal amp Professional development funds <p> <li> <li> <p> Family Planning Support <p> <li> <li> <p> Flexible Vacation amp Reddit Global Days Off <p> <li> <ul> <p> LIJD3 <p><p>
Senior SRE Engineer
Company: Finalsite
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> Finalsite is the preferred website communications enrollment and marketing platform of more than 7000 schools and school districts in 119 countries around the world The companys people products and services transform how schools connect and engage with their community recruit students and staff and fundraise while managing the complex requirements around data privacy accessibility hosting and security Finalsite products and services include awardwinning website designs a robust content management system mass communications tools a powerful enrollment management system innovative inbound marketing tools data integration training support and marketing consulting Finalsite is headquartered in Glastonbury CT USA with employees who work remotely in nearly every state in the US as well as Europe South America and Asia For more information please visit <a class=fontbold underline fontbold underline fontbold underline href=httpwwwfinalsitecom rel=noopener noreferrer nofollow target=blank> wwwfinalsitecom <a> <p> <p> <strong> VISION <strong> <p> <p> Finalsite will transform the way school communities engage with their schools <strong> SUMMARY OF THE ROLE <strong> <p> <p> As a <strong> Senior Site Reliability Engineer SRE <strong> you will be a key advocate for the health observability and maintainability of our production environment and its associated components The ideal candidate possesses a background in both software development and systems skills grounded in computer science fundamentals <p> <p> <strong> LOCATION <strong> <p> <p> 100 Remote Anywhere within the US <p> <p> <strong> RESPONSIBILITIES <strong> <p> <ul> <li> <p> <strong> Evangelism Skills <strong> Ability to articulate site reliability concepts in both business and technical terms fostering stakeholder buyin for key metrics like SLIsSLOs <p> <li> <li> <p> <strong> Fault Tolerance <strong> Deep understanding of fault tolerance in software and systems with expertise in discussing architectural design patterns <p> <li> <li> <p> <strong> Automation Mindset <strong> Strong desire to automate tasks employing infrastructure as code and tooling to eliminate toil <p> <li> <li> <p> <strong> Curiosity <strong> Natural curiosity to understand why and how things work going beyond functionality to comprehend the underlying mechanisms <p> <li> <li> <p> <strong> Total Ownership <strong> Willingness to take ownership investigate unfamiliar areas and contribute from browser to persistence layer with solid debugging skills <p> <li> <li> <p> <strong> Architectural Thinking <strong> Understanding of distributed computing fundamentals striving for system resilience selfhealing and reduced human intervention <p> <li> <ul> <p> <strong> QUALIFICATIONS AND SKILLS <strong> <p> <ul> <li> <p> Experience Minimum 46 years in DevOps SRE Systems or software development roles <p> <li> <li> <p> Email Delivery Experience Deep understanding of email delivery SMTP SPF DKIM DMARC is a must <p> <li> <li> <p> Cloud Expertise Extensive experience with public cloud platforms AWS GCP Azure <p> <li> <li> <p> Containerization Knowledge Deep understanding of workload orchestration and containerization Kubernetes Docker <p> <li> <li> <p> Automation Skills Proficiency in scripting Bash Ruby Python and infrastructure as code Terraform <p> <li> <li> <p> CICD Experience Familiarity with CICD platforms like GitLab or Jenkins <p> <li> <li> <p> Proven Track Record Demonstrated success in supporting critical production systems with minimal downtime <p> <li> <li> <p> Networking Basics Basic understanding of networking components including routing DHCP and DNS <p> <li> <li> <p> Availability Willingness to participate in our 24x7x365 oncall rotation <p> <li> <li> <p> Mentorship Experience Previous experience mentoring both developers and junior engineers <p> <li> <li> <p> Bonus Points Interest in HelmKapitan exposure to Ruby on Rails and interest and knowledge with Golang specifically within the context of the Kubernetes API <p> <li> <ul> <p> <p> <p> <a class=fontbold underline fontbold underline fontbold underline href=httpsdocsgooglecomdocumentu0d1F32PXkM5OJOZqkTI0IqeibEu9LnVr8AJUpjwIFG3v8edit rel=noopener noreferrer nofollow target=blank> Link to All Staff Competencies and Mental and Physical Requirements <a> <p> <p> <strong> RESIDENCY REQUIREMENT <strong> <p> <p> Finalsite offers 100 fully remote employment opportunities however these opportunities are limited to permanent residents of the United States Current residency as well as continued residency within the United States is required to obtain and retain employment with Finalsite <p> <p> <strong> DISCLOSURES <strong> <p> <p> Finalsite is proud to be an equal opportunity workplace and is an affirmative action employer We are committed to equal employment opportunity regardless of race color ancestry religion sex national origin sexual orientation age citizenship marital status disability gender identity or Veteran status We also consider qualified applicants regardless of criminal histories consistent with legal requirements EEO is the Law If you have a disability or special need that requires accommodation please contact Finalsites People Operations Team Finalsite is committed to the full inclusion of all qualified individuals As part of this commitment Finalsite will ensure that persons with disabilities or special needs are provided a reasonable accommodation Ensure your Finalsite job offer is legitimate and dont fall victim to fraud Ask your recruiter for a phone call or other type of verbal communication and ensure all email correspondence is from a finalsitecom email address For added security where possible apply through our company website at finalsitecomjobs <p><p>
Business Development - Public Sector
Company: Spruce
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> SpruceID is on a mission to help consumers take control and ownership of their identity and the data that is associated with it SpruceID is building a future where users own their identity and data across all digital interactions Our opensource credentialing infrastructure is standardscompliant productionready and extensible to typical enterprise and government IT systems Were a team of thoughtful nimble experts in opensourced software development user experience and public policy Transparency privacy and interoperability are hallmarks of our work <p> <p> <p> <p> We are hiring a business development wizard to own relationship management across the public sector to drive SpruceID business development including both netnew and expansion opportunities They will proactively strategize and prioritize opportunities across the federal and SLED landscape to optimize our GoToMarket efforts aligned with product strategy This role will also synthesize market learnings to inform our product development thought leadership and overall brand positioning <p> <p> <p> <p> Applicants to be considered for this role must be based in the United States <p> <p> <p> <p> <p> <p> <strong> Responsibilities <strong> <p> <ul> <li> <p> Research initiatives across federal and state level governments to inform and craft BD strategies <p> <li> <li> <p> Manage outreach campaigns and build relationships with relevant audiences <p> <li> <li> <p> Collaborate with Product team to identify and articulate relevant use cases and product opportunities <p> <li> <li> <p> Drive the full opportunity lifecycle from a relationship management perspective with high accountability <p> <li> <li> <p> Identify and close small quick wins while simultaneously managing extended complex sales cycles <p> <li> <li> <p> Manage and collaborate with consultants and lobbyists to drive Public Sector BD strategy <p> <li> <li> <p> Project manage internal coordination for responses to RFIs and RFPS <p> <li> <ul> <p> <p> <p> <strong> Qualifications <strong> <p> <ul> <li> <p> Minimum 5 years of demonstrated success selling to the public sector <p> <li> <li> <p> Deep understanding of federal andor SLED contracting processes <p> <li> <li> <p> Proven success in Business Development or other similar GTM role at a fastgrowing startup <p> <li> <li> <p> Excellent written and verbal communication including both technical and nontechnical topics <p> <li> <ul> <p> <p> <p> <strong> Bonus <strong> <p> <ul> <li> <p> Working understanding of the identity industry andor relevant technologies to digital verifiable credentials including ISO mDLs and W3C VCs <p> <li> <ul> <p> <p> <p> <p> <p> We are passionate about cultivating a thriving culture of diverse individuals who bring unique perspectives to our mission We are committed to equal employment opportunity regardless of race color ancestry religion sex national origin sexual orientation age citizenship marital status disability gender identity or Veteran status <p><p>
Controller
Company: Empower
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> <strong> EMPOWER OVERVIEW <strong> <p> <p> <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpempowerme rel=noopener noreferrer nofollow target=blank> Empower <a> is a financial technology company on a mission to expand access to fair credit and give anyone in the world the opportunity to improve their financial security and mobility Our vision is to underwrite the next billion people in the world using alternative data and machine learning to assess financial responsibility more thoughtfully and equitably Through innovative credit products offered in a userfriendly mobile experience were making credit more accessible and inclusive and providing more people the chance they deserve to participate in our financial system <p> <p> <p> <p> Empower is backed by Sequoia Capital Blisce and Icon Ventures Are we the next great place to grow your impact and accelerate your career We think so <p> <p> Inc ranked Empower 56 in the 2023 Inc 5000 list of the fastestgrowing private companies in the US 55 in 2022 Forbes put Empower on its 2023 list of Americas Best Startup Employers Fast Company recognized the new Empower Thrive line of credit in their 2022 list of the Next Big Things in Tech <p> <p> <p> <p> <strong> THE EMPOWER WAY <strong> <p> <p> <strong> Great Expectations <strong> We come up with bold audacious goals for ourselves and go all out for impact <p> <p> <strong> Owner Mindset <strong> We give every employee latitude to act independently make smart choices and move the business forward <p> <p> <strong> Spirited Debate <strong> We love skeptics and seek counter opinions to challenge our personal assumptions and expand our view <p> <p> <strong> Customer Obsession <strong> We listen to understand empathize and create a memorable rewarding experience for our community <p> <p> <strong> Inclusive Collaboration <strong> We believe diverse teams make the best decisions and we strive to give diverse voices a seat at the table <p> <p> N <strong> o Jerks Allowed <strong> We value our relationships and take the time to build trust and connection and communicate respectfully <p> <p> <strong> <strong> <p> <p> <strong> <strong> <p> <p> <strong> WHAT EMPOWER OFFERS <strong> <p> <p> Competitive salary <p> <p> Generous equity package <p> <p> Full healthcare and dental benefits <p> <p> Technology expense reimbursement <p> <p> Work from anywhere <p> <p> <p> <p> <strong> JOB DESCRIPTION <strong> <p> <p> As Controller you will report to the CFO and be responsible for ensuring the integrity accuracy and transparency of our financial reporting The ideal candidate will have a proven track record of leadership in financial control within the FinTech or related industries with experience guiding companies through significant growth phases and public offerings <p> <p> <p> <p> Travel for company offsites is expected at a minimum 2 times a year <p> <p> <p> <p> <p> <p> <strong> Key Responsibilities <strong> <p> <ul> <li> <p> Financial Leadership Lead the accounting function ensuring accurate and timely financial reporting in accordance with GAAP as well as compliance with SEC regulations and other applicable laws <p> <li> <li> <p> Strategic Planning Work closely with the CFO and FPampA team to develop financial strategies that support the companys growth objectives <p> <li> <li> <p> Internal Controls and Compliance Design implement and maintain a robust system of internal controls to safeguard company assets and ensure the accuracy of financial statements <p> <li> <li> <p> Team Management and Development Build lead and mentor a highperforming accounting team capable of supporting the companys growth and adaptability through its scaling and IPO journey <p> <li> <li> <p> Stakeholder Communication Act as a key liaison with external auditors regulatory bodies and investors ensuring clear and transparent communication of the companys financial status and outlook <p> <li> <li> <p> Process Improvement Continuously assess and improve financial and accounting processes and systems to increase efficiency reduce risk and support scaling operations <p> <li> <ul> <p> <p> <p> <strong> Candidate Qualifications <strong> <p> <ul> <li> <p> Bachelors degree in Accounting Finance or related field CPA or equivalent certification is required <p> <li> <li> <p> 10+ years of progressive experience in accounting and finance with at least 5 years in a leadership role within a FinTech or fastgrowing tech company <p> <li> <li> <p> Demonstrated experience leading a company through significant growth phases <p> <li> <li> <p> Strong knowledge of GAAP SEC reporting and regulatory compliance requirements in the financial services industry <p> <li> <li> <p> Exceptional leadership skills with the ability to develop and mentor a team <p> <li> <li> <p> Strategic thinker with excellent analytical organizational and problemsolving skills <p> <li> <li> <p> Outstanding communication and interpersonal abilities to engage with all levels of the organization and external stakeholders <p> <li> <li> <p> Proficient in financial software and systems including NetSuite with a keen eye for leveraging technology to improve operational efficiency <p> <li> <ul> <p> <p> <p> <p> <p> $180000 $220000 a year <p> <p> For US based employees this salary range includes several career levels of consideration and will be discussed further during the interview process The salary range is based on a variety of factors such as candidate experience qualifications and business needs The base pay range is subject to change and may be modified in the future <p> <p> At Empower we hire for people that push themselves to understand others and seek out ways to challenge their personal assumptions Our hope is that by fostering such an environment we strengthen our business and relationships by putting people first We are committed to building a diverse inclusive and equitable workspace where everyone regardless of age education ethnicity gender sexual orientation or any personal characteristics feels like they belong Even if your experience doesnt exactly match up to our job description you should feel empowered to apply regardless <p><p>
Legal Assistant
Company: Kraken
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <h1> <strong> Building the Future of Crypto <strong> <h1> <p> Our Krakenites are a worldclass team with crypto conviction united by our desire to discover and unlock the potential of crypto and blockchain technology <p> <p> <p> <p> <strong> What makes us different <strong> <p> <p> Kraken is a missionfocused company rooted in crypto values As a Krakenite youll join us on our mission to accelerate the global adoption of crypto so that everyone can achieve financial freedom and inclusion For over a decade Krakens focus on our mission and crypto ethos has attracted many of the most talented crypto experts in the world <p> <p> <p> <p> Before you apply please read the <a class=fontbold underline fontbold underline postingslink href=httpswwwkrakencomculture rel=noopener noreferrer nofollow target=blank> <u> Kraken Culture <u> <a> page to learn more about our internal culture values and mission <p> <p> <p> <p> As a fully remote company we have Krakenites in 60+ countries who speak over 50 languages Krakenites are industry pioneers who develop premium crypto products for experienced traders institutions and newcomers to the space Kraken is committed to <a class=fontbold underline fontbold underline postingslink href=httpsblogkrakencomcryptoeducationsecurityatkraken rel=noopener noreferrer nofollow target=blank> <u> industryleading security <u> <a> <a class=fontbold underline fontbold underline postingslink href=httpsblogkrakencomcategorycryptoeducation rel=noopener noreferrer nofollow target=blank> <u> crypto education <u> <a> and <a class=fontbold underline fontbold underline postingslink href=httpsblogkrakencomcryptoeducationsupportatkraken rel=noopener noreferrer nofollow target=blank> <u> worldclass client support <u> <a> through our products like <a class=fontbold underline fontbold underline postingslink href=httpsprokrakencom rel=noopener noreferrer nofollow target=blank> <u> Kraken Pro <u> <a> <a class=fontbold underline fontbold underline postingslink href=httpswwwkrakencomenusnft rel=noopener noreferrer nofollow target=blank> <u> Kraken NFT <u> <a> and <a class=fontbold underline fontbold underline postingslink href=httpsfutureskrakencomwallets rel=noopener noreferrer nofollow target=blank> <u> Kraken Futures <u> <a> <p> <p> <p> <p> <strong> Become a Krakenite and build the future of crypto <strong> <p> <p> <strong> The Team <strong> <p> <p> Join our growing worldwide Corporate Legal team of more than 12 attorneys and paraprofessionals working on matters such as international corporate structuring product formation MampA transactions public company preparedness and equity financing to further Krakens mission <p> <p> <p> <p> <strong> This is a fully remote role for a Legal Assistant Corporate Governance in the United States <strong> <p> <p> <p> <p> <strong> The Opportunity <strong> <p> <ul> <li> <p> Assist with all filing and reporting requirements for Krakens US entities <p> <li> <li> <p> Facilitate schedule and coordinate legal entity board and committee meetings assist with preparation of board decks and presentations <p> <li> <li> <p> Maintain and update corporate records registers of officers and directors and documentation for global subsidiaries <p> <li> <li> <p> Help coordinate organize schedule and prepare for key strategic meetings ie create summarized agendas <p> <li> <li> <p> Prepare and transmit documents for execution and ensure timely completion <p> <li> <li> <p> Maintain the legal knowledge management system for global corporate matters <p> <li> <li> <p> Help with implementation of SOPs for corporate team processes and initiatives <p> <li> <li> <p> Assist with companywide KYC requests <p> <li> <li> <p> Maintain corporate secretary Google Voice Account <p> <li> <li> <p> Support the MampA team with closing preparation and coordination <p> <li> <li> <p> Contribute to projects both big and small with no job too insignificant and no challenge too great <p> <li> <ul> <p> <p> <p> <strong> Skills You Should HODL <strong> <p> <ul> <li> <p> 1 to 2 years of experience as a corporate legal assistant mix of large law firm andor inhouse experience preferred <p> <li> <li> <p> Strong organizational and multitasking skills <p> <li> <li> <p> Excellent judgment and attention to detail a high level of accuracy in recordkeeping <p> <li> <li> <p> Excellent written and verbal communication skills in English Additional language skills are a bonus <p> <li> <li> <p> Ability to work both independently and collaboratively in a fastpaced environment <p> <li> <li> <p> Tech savvy quick to learn new software tools and skills <p> <li> <li> <p> Proficiency with Google Suite Google Drive Gmail Google Calendar <p> <p> <p> <li> <ul> <p> <strong> Nice to Have <strong> <p> <ul> <li> <p> Experience with regulated financial services companies <p> <li> <li> <p> Experience in the crypto industry <p> <li> <ul> <p> Location Tagging US LIKF1 LIRemote <p> <p> Kraken is powered by people from around the world and we celebrate all Krakenites for their diverse talents backgrounds contributions and unique perspectives We hire strictly based on merit meaning we seek out the candidates with the right abilities knowledge and skills considered the most suitable for the job We encourage you to apply for roles where you dont fully meet the listed requirements especially if youre passionate or knowledgable about crypto <p> <p> <p> <p> As an equal opportunity employer we dont tolerate discrimination or harassment of any kind Whether thats based on race ethnicity age gender identity citizenship religion sexual orientation disability pregnancy veteran status or any other protected characteristic as outlined by federal state or local laws <p> <p> <strong> Stay in the know <strong> <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpstwittercomkrakenfx rel=noopener noreferrer nofollow target=blank> <u> Follow us on Twitter <u> <a> <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpsblogkrakencom~text=Enter20your20email20address rel=noopener noreferrer nofollow target=blank> <u> Learn on the Kraken Blog <u> <a> <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpswwwlinkedincomcompanykrakenexchange rel=noopener noreferrer nofollow target=blank> <u> Connect on LinkedIn <u> <a> <p><p>
Governance Development
Company: Gauntlet
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> Gauntlet leads the field in quantitative research and optimization of DeFi economics We manage market risk optimize growth and ensure economic safety for protocols facilitating the majority of spot trading borrowing and lending activity across all of DeFi protecting and optimizing the largest protocols and networks in the industry As of January 2024 Gauntlet manages risk and incentives covering over $13 billion in customer TVL <p> <p> <p> <p> Gauntlet continually publishes cuttingedge research that informs our risk models alerts and analysis and is among the most cited institution including academic institutions in terms of peerreviewed papers addressing DeFi as a subject Were a Series B company with around 60 employees operating remotefirst with a home base in New York City <p> <p> <p> <p> Gauntlets mission is to <strong> drive adoption and understanding in the financial systems of the future <strong> Building with decentralized systems creates novel challenges for mechanism designers smart contract developers and endusers of financial products which are not seen in traditional software development and investing contexts Gauntlet is dedicated to enhancing our industrys understanding of this new domain and revealing how to safely navigate the true bleeding edge of 21st century financial innovation <p> <p> <p> <p> Our extremely passionate team works tirelessly to bridge the gap for datadriven insights and analytical research in collateralized blockchain protocols We strive to maintain an atmosphere that fosters innovation and new ideas through collaboration research and deep discussion to meet our customers needs to grow and manage incentives better <p> <p> <p> <p> In order to grow our impact in the DeFi space we are looking to hire an experienced cryptonative Governance actor to support Gauntlets increasing delegate activities This role will be an active participant in the DAOs where Gauntlet is a delegate ongoing forum participation maintaining exemplary voting and communication rates and joining delegate calls or other DAOrelated events among other things This role will also actively seek out opportunities for new delegation and proactively identify potential revenue opportunities that align with Gauntlets business <p> <p> <p> <p> <p> <p> <strong> Responsibilities <strong> <p> <ul> <li> <p> Develop an intricate understanding of the DAOs where Gauntlet is or becomes a delegate <p> <li> <li> <p> Active forum participation commenting on proposals and other DAOwide conversations <p> <li> <li> <p> Internal collaboration around decisionmaking for on and offchain votes <p> <li> <li> <p> Ensure Gauntlet maintains a 100 voting and participation rate <p> <li> <li> <p> Proactively identify revenue opportunities that identify with Gauntlets product suite <p> <li> <li> <p> Actively seek increased and net new delegation <p> <li> <li> <p> Maintain active reporting on decidedupon metrics for internal tracking <p> <li> <li> <p> Work crossfunctionally as needed with Data Science Product and Engineering <p> <li> <li> <p> Maintain a pulse and viewpoint on emerging trends in DeFi and adjacent industries <p> <li> <ul> <p> <p> <p> <strong> Qualifications <strong> <p> <ul> <li> <p> Demonstrated DeFi native governanceDAO experience <p> <li> <li> <p> Deep understanding of the DeFi landscape and emerging trends <p> <li> <li> <p> Comfortable working crossfunctionally with Product Engineering Data Science and Finance teams to ensure successful outcomes <p> <li> <li> <p> Excellent verbal and written communication skills <p> <li> <li> <p> Exceptional attention to detail and ability to prioritize <p> <li> <li> <p> Ability to operate autonomously and across multiple time zones <p> <li> <li> <p> You have an analytical background <p> <li> <ul> <p> <p> <p> <strong> Bonus Points <strong> <p> <ul> <li> <p> You have a cryptonative network <p> <li> <li> <p> Youve served as a delegate in a large DAO participated in a blockchain club or professional delegate <p> <li> <li> <p> Youve served as a governance lead for your organization in a bluechip protocol <p> <li> <li> <p> Youve held positions on grants councils or similar <p> <li> <li> <p> You have a technical or mathematical background and are able to disseminate technical topics to nontechnical audiences <p> <li> <ul> <p> <p> <p> <strong> Benefits and Perks <strong> <p> <ul> <li> <p> Remote first work from anywhere in the US amp CAN <p> <li> <li> <p> Regular inperson company retreats and crosscountry office visit perk <p> <li> <li> <p> 100 paid medical dental and vision premiums for employees <p> <li> <li> <p> Laptop monitor keyboard and mouse setup provided <p> <li> <li> <p> $1000 WFH stipend <p> <li> <li> <p> Monthly reimbursement for home internet phone and cellular data <p> <li> <li> <p> Unlimited vacation <p> <li> <li> <p> 100 paid parental leave of 12 weeks <p> <li> <li> <p> Fertility benefits <p> <li> <li> <p> Opportunity for incentive compensation <p> <li> <ul> <p> <p> <p> <p> <p> <strong> Please note at this time our hiring is reserved for potential employees who are able to work within the contiguous United States and Canada Should you need alternative accommodations please note that in your application <strong> <p> <p> <p> <p> <em> The national pay range for this role is $120000 base plus additional On Target Earnings potential by level and equity in the company Our salary ranges are based on paying competitively for a company of our size and industry and are one part of many compensation benefits and other reward opportunities we provide Individual pay rate decisions are based on a number of factors including qualifications for the role experience level skill set and balancing internal equity relative to peers at the company <em> <p> <p> <p> <p> LIRemote <p><p>
English Teacher
Company: Enlego
Location: USA
Posted Apr 30, 2024
Enlego offers personalized online English courses taught by native speaking, fluent ESL teachers. The company focuses on developing students' communicative proficiency and employs strict recruitment criteria to ensure quality. Teachers guide students throughout their studies, providing engaging and interactive lessons, and employ communicative teaching techniques tailored to each student's needs.