Direct Hire Authority (Dha) Solicitation Jobs in USA
332,827 open positions · Updated daily
Looking for Direct Hire Authority (Dha) Solicitation jobs in USA? Browse our curated listings with transparent salary information to find the perfect Direct Hire Authority (Dha) Solicitation position in the USA area.
Senior Software Engineer - Cosmos Platform
Company: Bishop Fox
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> Bishop Fox is the leading authority in offensive security providing solutions ranging from continuous penetration testing red teaming and attack surface management to product cloud and application security assessments Weve worked with more than a quarter of the Fortune 100 half of the Fortune 10 eight of the top 10 global technology companies and all of the top global media companies Our Cosmos platform service innovation and culture of excellence continue to gather accolades from industry award programs including Fast Company Inc SC Media and others For more than 16 years weve been contributing and giving back to the security community Weve published more than 16 open source tools and 50 security advisories in the last five years alone Learn more at bishopfoxcom or follow us on social media <p> <p> Given our exceptional growth we are expanding and hiring a Software Engineer to join us on this exciting journey At Bishop Fox you will join a company of brilliant technologists to help build THE platform for offensive security Cosmos Working on Cosmos you will have the opportunity to build eventdriven domainoriented services across a wide spectrum of offensive security capabilities Each day will bring new challenges and problems to solve If you have strong experience with modern architecture cloud and languages such as Golang and Python are selfmotivated and enjoy solving problems at scale then the Cosmos Platform Engineering team is for you Bring your experience curiosity and will to deliver great technology and join our Cosmos Platform team <p> <h3> Responsibilities <h3> <p> As a member of the Cosmos Platform Engineering team you will design solutions write code and usher software into production You will build services that industrialize the automation of offensive security processes and provide security information to our customers in a scalable secure reliable cloud platform <p> <p> As a Senior Engineer you will take the lead on design solutions drive quality standards and provide technical leadership to the team and broader engineering organization <p> <h3> Requirements <h3> <ul> <li> <p> 5+ years of software development experience <p> <li> <li> <p> Professional experience with Golang or Python required <p> <li> <li> <p> Mastery in the foundations of Golang or Python and strong experience in building microservices in the specified language <p> <li> <li> <p> Experience in a professional software organization using an SDLC <p> <li> <li> <p> Understanding of coding best practices structure patterns unit tests secure coding etc <p> <li> <li> <p> Ability to work independently and also work together with the team to solve complex technical problems <p> <li> <ul> <h3> Preferred Skills and Experience <h3> <ul> <li> <p> Experience with Amazon Web Services AWS <p> <li> <li> <p> Eventdriven and asynchronous systems Rabbit SQS SNS Kafka Kinesis etc <p> <li> <li> <p> Experience using datastores SQL or NoSQL <p> <li> <li> <p> An interest in cybersecurity <p> <li> <ul> <p> Bishop Fox has always allowed its employees to work remotely and this role could work anywhere in the United States Our comprehensive benefits program is tailored to meet your needs at an affordable price We embrace diversity and an inclusive culture We value our employees and who they are which fosters a powerful and collective talent base to successfully serve our clients and the security community with unparalleled expertise <p> <p> <em> Bishop Fox is an Equal Opportunity employer All qualified applicants will receive consideration for employment without regard to race color religion sex including sexual orientation and gender identity national origin disability protected veteran status or any other characteristic protected by applicable federal state or local law All new hires must pass a background check as a condition of employment <em> <p> <p> Interested Apply today <p><p>
Director - Corporate FP&A
Company: Icertis
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> With unmatched technology and categorydefining innovation Icertis pushes the boundaries of whats possible with contract lifecycle management CLM The AIpowered analystvalidated Icertis Contract Intelligence ICI platform turns contracts from static documents into strategic advantage by structuring and connecting the critical contract information that defines how an organization runs Today the worlds most iconic brands and disruptive innovators trust Icertis to fully realize the intent of their combined 10 million contracts worth more than $1 trillion in 40+ languages and 93 countries <p> <p> <p> <p> <strong> Who we are <strong> Icertis is the only contract intelligence platform companies trust to keep them out in front now and in the future Our unwavering commitment to contract intelligence is grounded in our FORTE valuesFairness Openness Respect Teamwork and Executionwhich guide all our interactions with employees customers partners and stakeholders Because in our mission to be the contract intelligence platform of the world we believe how we get there is as important as the destination <p> <p> <p> <p> As the Director of FPampA you will play a critical leadership role you will work closely with all of companys functional leaders and bring key market strategic and operational insights that will shape the direction of the company and accelerate its growth You will also play a key role in telling the companys financial story to investors <p> <p> <p> <p> The ideal candidate will have a proven trackrecord of driving business outcomes through keen financial insight and business modeling They will have the ability to create a 360degree financial picture of the business that reflects and influences the companys strategy and be excellent at communicating with senior leaders and executives They will be toolsavvy with experience in creating scalable data and reporting solutions that support a datadriven culture LIRS1 <p> <p> <p> <p> <p> <p> <strong> What you will do <strong> <p> <ul> <li> <p> Formulate a robust 360degree financial picture of the business complete with market insights and operational drivers <p> <li> <li> <p> Develop and maintain the 3year Strategic Planning Model and forecast <p> <li> <li> <p> Deliver Global PampL and cash flow forecasts <p> <li> <li> <p> Drive Annual Planning Process work cross functionally to build and maintain the Annual Financial Plan and Departmental Budgets <p> <li> <li> <p> Build and deliver Business Performance ReportingOperating dashboards <p> <li> <li> <p> Perform strategic business analysis as needed MampA Geo Expansion <p> <li> <li> <p> Prepare financial analyses as needed to help drive improvements in the business Current focus areas include market expansion opportunities competitive benchmarking analyses pricing and strategic financial optimization strategies <p> <li> <li> <p> Partner with Controller to enhance and accelerate the financial reporting process <p> <li> <li> <p> Identifies and implements system and process improvements to increase the efficiency and effectiveness of planning and reporting workflows <p> <li> <li> <p> Prepare communications to Board of Directors <p> <li> <li> <p> Drive investor presentations and supporting analysis <p> <li> <li> <p> Develop a deep understanding of the business metrics with an eye towards understanding the benefits and risks from a financial perspective and helping to manage key business drivers and desired outcomes <p> <li> <li> <p> Play a key role in preparation of critical public financial documents to support the IPO process including working with bankers and supporting the production of investor materials and SEC filings eg S1 <p> <li> <ul> <p> <p> <p> <strong> What you will bring <strong> <p> <ul> <li> <p> 12+ years of experience of working in direct strategic analysis support of all aspects of the business at all areas of the PampL <p> <li> <li> <p> MBACPA or equivalent experience preferred <p> <li> <li> <p> Demonstrated complex modeling experience this is a handson role and managers are expected to directly contribute and lead by example <p> <li> <li> <p> Highly analytical detailoriented with a commitment to creating a highquality product Naturally inquisitive and able to extract information from various sources to identify and understand the underlying issue Not afraid to question results <p> <li> <li> <p> Prior success working in a fastpaced entrepreneurial environment takes initiative and works independently <p> <li> <li> <p> Working knowledge of accounting principles required including revenue recognition amortization and accrual vs cash accounting Must have a general understanding of financial statements <p> <li> <li> <p> Must have exceptional written visual and spoken communication skills <p> <li> <li> <p> Experience in preparing and delivering executive board and investor level communications <p> <li> <li> <p> IPO experience is a plus <p> <li> <li> <p> Must have advanced Excel Netsuite and Powerpoint skills <p> <li> <li> <p> Experience implementing financial analysis and planning tools required <p> <li> <ul> <p> <p> <p> <p> <p> $146000 $219000 a year <p> <p> <em> Pay offered will vary based on jobrelated factors such as location experience training skills and abilities In addition to the base salary and annual bonus target and an equity component is included in the compensation package <em> <p> <p> <strong> What we offer <strong> <p> <p> We are committed to the health and wellbeing of all Icertians their families the communities they live in and our customers This commitment is represented in the Icertis Four Rings of Responsibility Take Care of Self Take Care of Family Take Care of Community and Take Care of Business in that order <p> <p> <p> <p> To support these commitments Icertis offers excellent health and welfare benefits a generous 401k match and a robust paid time off program Here are some of the other reasons <a class=fontbold underline fontbold underline postingslink href=httpswwwicertiscomcompanynewsicertisplacesfirstinwashingtons100bestcompaniestoworkfor rel=noopener noreferrer nofollow target=blank> Icertis Places First in Washingtons 100 Best Companies to Work For | Icertis <a> <p> <p> <p> <p> ● Equity RSUs and shared ownership in the company <p> <p> ● Flexible work environment <p> <p> ● Paid maternity and paternity leave <p> <p> ● 7 Days for Humanity 7 paid volunteer days <p> <p> ● Generous holidays including the 4th of July week off paid <p> <p> ● Free professional and leadership coaching <p> <p> ● Annual personal development allowance <p> <p> <p> <p> Icertis Inc provides Equal Employment Opportunity to all employees and applicants for employment without regard to race color religion gender identity or expression sex sexual orientation national origin age disability genetic information marital status amnesty or status as a covered veteran in accordance with applicable federal state and local laws Icertis Inc complies with applicable state and local laws governing nondiscrimination in employment in every location in which the company has facilities If you are in need of accommodation or special assistance to navigate our website or to complete your application please send an email with your request to <a class=fontbold underline fontbold underline postingslink href=mailtocareersicertiscom rel=noopener noreferrer nofollow target=blank> careersicertiscom <a> or get in touch with your recruiter <p> <p> <p> <p> By submitting your application you acknowledge that you have read Icertiss Privacy Policy <a class=fontbold underline fontbold underline postingslink href=httpswwwicertiscomprivacystatement rel=noopener noreferrer nofollow target=blank> httpswwwicertiscomprivacystatement <a> <p> <p> <p> <p> Icertis is not open to third party solicitation or resumes for our posted FTE positions Resumes received from third party agencies that are unsolicited will be considered complimentary <p><p>
Distributed Systems Engineer, L5 - OC Tools Runtime
Company: Netflix
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> How do you spark joy in hundreds of millions of people It starts with a vision that technology can give voice to stories around the world In delivering those muchloved stories Netflix is responsible for a significant portion of global internet traffic <p> <p> <p> <p> To steward that responsibility we work collaboratively with ISPs to deploy <a class=fontbold underline fontbold underline postingslink href=httpsmedianetflixcomencompanybloghownetflixworkswithispsaroundtheglobetodeliveragreatviewingexperience rel=noopener noreferrer nofollow target=blank> Open Connect <a> Netflixs Content Delivery Network CDN which delivers 100 of Netflixs video traffic Our teams mission is to support that delivery by providing an automation and tooling platform that supports the internal operations and external partnerships needed to provide a fantastic viewing experience for all Netflix members We are looking for a talented software engineer specializing in infrastructure to join us on that mission <p> <p> <p> <p> <strong> The Role <strong> <p> <p> You will be charged with handling impactful availability scalability and usability challenges and must selfdefine optimal ways to configure manage and observe our growing Open Connect platform Our platform is a fundamental building block to our streaming initiatives providing critical solutions for one of the worlds largest CDNs and empowering stakeholders to operate the CDN more efficiently and reliably <p> <p> <p> <p> <p> <p> <p> <p> <strong> In this position you will have the opportunity to work in a wide variety of areas such as <strong> <p> <ul> <li> <p> Implementing microservices to enable analytics insights discovery and visualizations <p> <li> <li> <p> Designing orchestration to manage many thousands of globally distributed appliances and devices <p> <li> <li> <p> Building data models and APIs to help manage and maintain our fleet <p> <li> <li> <p> Understanding the breadth of our multitenant platform creating generalized solutions which can be leveraged across multiple domains including networking video and gaming <p> <li> <ul> <p> <p> <p> <strong> You Are <strong> <p> <ul> <li> <p> Someone who likes to work handson and selfdirect in a fastpaced environment that gives you great freedom and responsibility <p> <li> <li> <p> Able to see beyond immediate specifications can summarize requirements and architect forwardlooking solutions that cross multiple applications <p> <li> <li> <p> Capable of working in a highlycollaborative environment alongside your teammates engineers Partner Engagement Managers project managers and operations teams <p> <li> <li> <p> Articulate in communicating opportunities for continuous improvements to existing systems with a clear understanding of the impact on the business <p> <li> <li> <p> Always striving to develop and deploy in measured increments while taking responsibility for the quality of your work <p> <li> <ul> <p> <p> <p> <strong> Required Skills <strong> <p> <ul> <li> <p> 5+ years of expertise in Java or similar objectoriented language with confidence and experience in debugging and problemsolving skills <p> <li> <li> <p> Deep understanding of cloud architecture and application deployment <p> <li> <li> <p> Ability to build and support highly scalable robust and faulttolerant services <p> <li> <li> <p> Comprehensive knowledge of architecting and maintaining largescale distributed systems while handling high concurrency <p> <li> <li> <p> Experience designing implementing and debugging systems that interact with largesized data sets <p> <li> <li> <p> Excellent verbal and written communication skills <p> <li> <ul> <p> <p> <p> <strong> Bonus Skills <strong> <p> <ul> <li> <p> Knowledge of CDN architectures and networking fundamentals TCPIP BGP DNS <p> <li> <li> <p> Experience with multiple data stores and streaming services such as MySQL Postgres Elasticsearch Cassandra Kafka or Redis <p> <li> <li> <p> Familiarity with GraphQL or related graph modeling and querying concepts <p> <li> <li> <p> Handson Big Data experience using Hive Pig Hadoop or similar <p> <li> <li> <p> Understanding of frontend technologies including HTML CSS JavaScript WebSockets <p> <li> <ul> <p> <p> <p> <p> <p> Does this sound interesting Or does this sound interesting but intimidating Please dont selfselect out lets figure it out together Wed love to talk to you <p> <p> <p> <p> Our culture is unique and we tend to live by our values so its worth learning more about Netflix <a class=fontbold underline fontbold underline postingslink href=httpsjobsnetflixcomculture rel=noopener noreferrer nofollow target=blank> here <a> <p> <p> <p> <p> Our compensation structure consists solely of an annual salary we do not have bonuses You choose each year how much of your compensation you want in salary versus stock options To determine your personal top of market compensation we rely on market indicators and consider your specific job family background skills and experience to determine your compensation in the market range The range for this role is $100000 $720000 <p> <p> <p> <p> Netflix provides comprehensive benefits including Health Plans Mental Health support a 401k Retirement Plan with employer match Stock Option Program Disability Programs Health Savings and Flexible Spending Accounts Familyforming benefits and Life and Serious Injury Benefits We also offer paid leave of absence programs Fulltime hourly employees accrue 35 days annually for paid time off to be used for vacation holidays and sick paid time off Fulltime salaried employees are immediately entitled to flexible time off See more detail about our Benefits <a class=fontbold underline fontbold underline postingslink href=httpsjobsnetflixcomworklifephilosophy rel=noopener noreferrer nofollow target=blank> here <a> <p> <p> <p> <p> Netflix is a unique culture and environment Learn more <a class=fontbold underline fontbold underline postingslink href=httpsjobsnetflixcomculture rel=noopener noreferrer nofollow target=blank> here <a> <p> <p> <p> <p> We are an equalopportunity employer and celebrate diversity recognizing that diversity of thought and background builds stronger teams We approach diversity and inclusion seriously and thoughtfully We do not discriminate on the basis of race religion color ancestry national origin caste sex sexual orientation gender gender identity or expression age disability medical condition pregnancy genetic makeup marital status or military service <p><p>
Senior Software Engineer - Ruby on Rails, Backend
Company: Synack
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> At Synack we create technology that unleashes the best cybersecurity talent to secure our digital world <p> <p> We protect leading global organizations by reducing companies security risk and increasing their resistance to cyber attack How do we do this By utilizing the worlds best and most trusted team of ethical hackers who test through our powerful and controlled platform to deliver real security without compromise <p> <p> Backed by toptier venture capital firms including Kleiner Perkins Caufield amp Byers Microsoft and Google Ventures Synacks mission is to leverage global security talent coupled with advanced technology to help enterprises discover security vulnerabilities before they become business problems Discover the possibilities at Synack <p> <p> Are you ready to leverage your software development skills to build a platform that is transforming cybersecurity As a Senior Software Engineer Ruby on Rails Backend you will be part of a fastpaced collaborative team developing our cybersecurity platforms You will be a critical contributor to the development of the system while implementing engineering best practices If you enjoy pivoting between different problems and meeting new challenges every day while developing a solution that is mission critical to the organization this role is for you Sounds interesting Keep reading <p> <p> <strong> Please note <strong> This is a remote position based in the US We can only hire US citizens for this position due to federal government contract requirements <p> <p> <p> <p> <strong> Heres what youll do <strong> <p> <ul> <li> <p> Design develop and maintain highly scalable and available microservices hosted on Google Cloud Platform and Azure <p> <li> <li> <p> Collaborate with the product team and engineering leadership in requirements gathering planning and estimation <p> <li> <li> <p> Architect and implement business logic in Ruby on Rails backend and Relational data store <p> <li> <li> <p> Develop and evolve APIs to interface with Web UI <p> <li> <li> <p> Write clean maintainable and efficient code following our coding standards <p> <li> <li> <p> Identify and resolve performance bottlenecks bugs and backend issues <p> <li> <li> <p> Participate in system design code reviews and production releases <p> <li> <li> <p> Contribute to our technical documentation and update system and data flow diagrams as you introduce new features <p> <li> <ul> <p> <strong> Heres what youll need <strong> <p> <ul> <li> <p> 8+ years designing and building dynamic production solutions <p> <li> <li> <p> Solid understanding of objectoriented programming <p> <li> <li> <p> 8+ years in a Ruby on Rails <p> <li> <li> <p> 2+ years experience with building and deploying containerized applications K8s is a bonus <p> <li> <li> <p> Solid backend experience with background jobs processors such as SideKiq <p> <li> <li> <p> Experience with queue and messaging solutions such as PubSubKafka <p> <li> <li> <p> Experience designing and building RESTful APIs <p> <li> <li> <p> Experience with testing tools such as Rspec Jest TestCafe React Testing Library <p> <li> <li> <p> Understanding of various database systems such as RDBMS and NOSQL <p> <li> <li> <p> Experience working with cloud hosted environments <p> <li> <ul> <p> <strong> Great to have <strong> <p> <ul> <li> <p> 2+ years using ReactJSRedux or other JavaScript frameworks and libraries <p> <li> <li> <p> 2+ years of experience with Golang <p> <li> <li> <p> Experience with GCP <p> <li> <li> <p> Experience working in Cyber security problem space <p> <li> <ul> <p> <strong> Ready to join us <strong> <p> <p> Synack is committed to embracing diversity Our people are our strength Each addition to our team is an opportunity to grow and diversify our ideas experiences and viewpoints We strive to be inclusive of Race Ethnicity Religion Sex LGBTQ+ Veterans Disabilities and Age Synack welcomes you <p> <p> As a candidate Synack cares about your privacy Please view our candidate privacy policy <a class=fontbold underline fontbold underline fontbold underline href=httpswwwsynackcomcandidateprivacynotice rel=noopener noreferrer nofollow target=blank> here <a> <p> <p> <strong> $115000 $230000 py <strong> Salary is determined by a combination of factors including location level relevant experience and skills The range displayed on each job posting reflects the minimum and maximum target for new hire salaries for the position across all US locations The compensation package for this position may also include equity and benefits For more details about our benefits please see <a class=fontbold underline fontbold underline fontbold underline href=httpssynackmybenefitslife rel=noopener noreferrer nofollow target=blank> here <a> Then for the Employer code enter <strong> synack <strong> <p><p>
Senior iOS Software Engineer
Company: Empower
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> <strong> EMPOWER OVERVIEW <strong> <p> <p> <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpempowerme rel=noopener noreferrer nofollow target=blank> Empower <a> is a highgrowth financial technology company on a mission to expand access to fair credit to give anyone in the world the opportunity to improve their financial security and mobility We dream up and launch oneofakind features that help our members get money instantly whenever they need it save for the future and rewrite their financial story Our members see Empower Cash Advance as a lifesaver Empower Automatic Savings as a gamechanger and the new Empower Thrive line of credit currently in beta launching soon as a lifeline to lowcost borrowing and the only practical path to building good credit <p> <p> <p> <p> Empower is backed by Sequoia Capital Blisce and Icon Ventures Are we the next great place to grow your impact and accelerate your career We think so <p> <p> <p> <p> Inc ranked Empower 56 in the 2023 Inc 5000 list of the fastestgrowing private companies in the US 55 in 2022 Forbes put Empower on its 2023 list of Americas Best Startup Employers Fast Company recognized the new Empower Thrive line of credit in their 2022 list of the Next Big Things in Tech <p> <p> <p> <p> <strong> THE EMPOWER WAY <strong> <p> <p> <strong> Great Expectations <strong> We come up with bold audacious goals for ourselves and go all out for impact <p> <p> <strong> Owner Mindset <strong> We give every employee latitude to act independently make smart choices and move the business forward <p> <p> <strong> Spirited Debate <strong> We love skeptics and seek counter opinions to challenge our personal assumptions and expand our view <p> <p> <strong> Customer Obsession <strong> We listen to understand empathize and create a memorable rewarding experience for our community <p> <p> <strong> Inclusive Collaboration <strong> We believe diverse teams make the best decisions and we strive to give diverse voices a seat at the table <p> <p> N <strong> o Jerks Allowed <strong> We value our relationships and take the time to build trust and connection and communicate respectfully <p> <p> <p> <p> <strong> <strong> <p> <p> <strong> WHAT EMPOWER OFFERS <strong> <p> <p> <p> <p> Competitive salary <p> <p> Generous equity package <p> <p> Full healthcare and dental benefits <p> <p> Technology expense reimbursement <p> <p> Work from anywhere <p> <p> <p> <p> <strong> JOB DESCRIPTION <strong> <p> <p> As an iOS Software Engineer youll create the iOS mobile app that powers the Empower customer experience Youll engage with a collaborative high powered team to develop solutions and lead product engineering on projects with a reach of millions The solutions youll build will be robust secure and easy to understand both for our users and your engineering peers Youll take end to end ownership of new features and product lines shaping work in early stages building deploying and running post deployment analysis to ensure were hitting our goals <p> <p> <p> <p> <p> <p> Travel for company offsites is expected at a minimum 2 times a year <p> <p> <p> <p> <p> <p> <strong> Key Responsibilities <strong> <p> <ul> <li> <p> Designing and building iOS mobile apps <p> <li> <li> <p> Contribution and adherence to software engineering standards and practices <p> <li> <li> <p> Implementing secure coding standards in accordance with the Empower Secure Development Policy <p> <li> <li> <p> Perform ongoing security testing and code review to improve software security <p> <li> <li> <p> Meeting sprint goals <p> <li> <li> <p> Leading andor supporting feature specification activities Product Engineering <p> <li> <li> <p> Monitoring the performance of the Empower mobile app and applying corrective action through bug fixing and general improvement <p> <li> <li> <p> Minimizing defects and improving reliability through Development of automated tests manual test validation development of fit for purpose architecture and code contributing to PRs <p> <li> <li> <p> Developing and maintaining the iOS app build pipeline <p> <li> <li> <p> Publishing the App to the App Store <p> <li> <li> <p> Collaborating crossfunctionally to define design and ship new features that create customer and business value <p> <li> <li> <p> Playing an active role in advising and collaborating with design and product to flesh out the specifications of each epic <p> <li> <li> <p> Writing engineering specs including acceptance criteria and server contracts <p> <li> <li> <p> Grooming stories for upcoming sprints <p> <li> <li> <p> Maximising effective development and identifying new technology opportunities by Keeping across iOS development announcements being across community best practice discovering and evaluating new technologies <p> <li> <ul> <p> <p> <p> <strong> Candidate Qualifications <strong> <p> <ul> <li> <p> Bachelor degree or greater within Computer Science Software Engineering or a related subject <p> <li> <li> <p> 5+ years developing consumer facing iOS apps <p> <li> <li> <p> Working experience in Swift and iOS UI Frameworks <p> <li> <ul> <p> <p> <p> <p> <p> At Empower we hire for people that push themselves to understand others and seek out ways to challenge their personal assumptions Our hope is that by fostering such an environment we strengthen our business and relationships by putting people first We are committed to building a diverse inclusive and equitable workspace where everyone regardless of age education ethnicity gender sexual orientation or any personal characteristics feels like they belong Even if your experience doesnt exactly match up to our job description you should feel empowered to apply regardless <p><p>
Product Design Manager, Tax Credits
Company: Gusto, Inc.
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> Product Design at Gusto is made up of over 60 creative collaborative people who care deeply about our mission to empower small businesses and their employees Were a crossfunctional bunch focused on Design Research Writing Ops and Frontend Development who are always looking for opportunities to build understanding and empathy for the people who use Gusto We dont care a whole lot about swim lanes and we work closely with our partners in Product Engineering Data and Marketing to design build and ship experiences that make a difference We are passionate advocates for thoughtful crafted and inclusive experiences and we believe great design can make hard things possible even delightful <a class=fontbold underline fontbold underline fontbold underline href=httpsgustodesignnotionsiteDesignthefutureofworkatGusto1208931e36ae4da399ea4fa43f11b1e1 rel=noopener noreferrer nofollow target=blank> Read more about Design at Gusto <a> <p> <p> <strong> About the team <strong> <p> <p> At Gusto were dedicated to simplifying the complex world of business operations As a powerful People Platform we offer a comprehensive suite of essential products including payroll benefits time tracking and more all designed to streamline processes and empower businesses to thrive Our commitment to worldclass customer experience sets us apart <p> <p> Our Tax Credits team at Gusto is bringing to life an emerging market product for our customers We aim to help guide them through intricate tax credit regulations unlock financial opportunities and extend the runway for their businesses The Tax Credits team has ambitious goals to drastically simplify and demystify the complex world of tax credits in order to drive significant customer value and revenue for our business <p> <p> <strong> About the opportunity <strong> <p> <p> As the Product Design Manager for the Tax Credits team youll lead a small team of product designers to craft high quality and intuitive endtoend experiences for our customers Youll leverage your strategic business acumen to partner with senior crossfunctional leaders to plan and drive the roadmap and multiyear vision The work on Tax Credits is high visibility high impact experiences that balance complex technical and compliance requirements Your leadership will play a pivotal role in simplifying the intricate journey of discovering and securing tax credits ensuring its approachable userfriendly and stressfree <p> <p> <strong> Heres what youll do daytoday <strong> <p> <ul> <li> <p> Develop a deep understanding of the different customers we serve and how their varying needs translate into product requirements <p> <li> <li> <p> Work with crossfunctional partners in Product Management Engineering and Data Science to understand customer problems and identify key opportunities for the customer and our business Youll be the design representative on the senior quartet <p> <li> <li> <p> Empower a small team of product designers creating the conditions for them to do work theyre proud of and that serves the needs of our customers <p> <li> <li> <p> Craft the endtoend journeys and develop frameworks and principles that can be used to help align our teams on the right experiences <p> <li> <li> <p> Collaborate with our Research Data Science and Customer Support teams to build a holistic understanding of customer needs and make sure theyre shared with your teams to inform their thinking build empathy and inform prioritization decisions <p> <li> <li> <p> Collaborate with other key teams and stakeholders at Gusto such as Legal Compliance Risk Operations and other various product owners <p> <li> <li> <p> Ensure that proposed solutions are customerinformed through research data and insights from our Customer Support team <p> <li> <li> <p> Balance an iterative approach and urgency to solve customer pain with ensuring that short term improvements ladder up to longterm vision and meet a high bar for the customer experience <p> <li> <li> <p> Hold high standards for the customer experience including partnering with engineering partners to refine the end customer experience and ensure that what we release is bug free performant accessible and responsive <p> <li> <li> <p> Drive solutions that establish Gusto as a trusted tax expert advisor empowering our customers to make confident and informed tax credit decisions <p> <li> <li> <p> Identify emerging technologies and industry trends build business cases and define product vision and strategy <p> <li> <li> <p> Youll drive teamwide impact through leadership coaching and fostering a culture of growth and collaboration <p> <li> <ul> <p> <strong> Heres what were looking for <strong> <p> <ul> <li> <p> 8+ years Product Design experience with at least 2 of those years being in management roles <p> <li> <li> <p> Ideally youve worked on enabling simple easy to use experiences in complex domains like payroll benefits finance or banking etc Bonus if you have direct experience working on tax andor accounting products <p> <li> <li> <p> A track record of upleveling direct reports and raising the bar for design quality within an organization <p> <li> <li> <p> A proven track record of designing great UX for complex workflows and crafting endtoend experience visions and frameworks while showcasing an iterative approach toward execution <p> <li> <li> <p> A customerfocused mindset and can speak to the impact of the experience theyve shipped in tangible terms the business understands <p> <li> <li> <p> Strong opinions loosely held and a willingness to engage in constructive debates about scope and tradeoffs to build alignment and unblock workYouve built great relationships with cross functional collaborators and know how to model this for your team <p> <li> <li> <p> A proven track record of designing great UX for complex workflows and crafting endtoend experience visions and frameworks while showcasing an iterative approach toward execution <p> <li> <li> <p> A customerfocused mindset and can speak to the impact of the experience theyve shipped in tangible terms the business understands <p> <li> <li> <p> Strong opinions loosely held and a willingness to engage in constructive debates about scope and tradeoffs to build alignment and unblock workYouve built great relationships with cross functional collaborators and know how to model this for your team <p> <li> <li> <p> Communication and collaboration skills that enable you to explain the impact of your work tradeoffs youve made lessons learned and design rationale and generate alignment and enthusiasm across the company <p> <li> <li> <p> Ability to embrace ambiguous situations as opportunities to add clarity <p> <li> <li> <p> A builder who loves being hands on crafting high quality high impact solutions directly and through pairing with more junior team members <p> <li> <ul> <p> At Gusto we strive to provide rewards that empower employees to achieve their financial and personal goals We offer competitive compensation packages with a strong emphasis on equity based compensation ownership in Gusto To learn more about Gustos compensation philosophy and benefits offerings please view our <a class=fontbold underline fontbold underline fontbold underline href=httpsgustocomaboutcareerstotalrewards rel=noopener noreferrer nofollow target=blank> Total Rewards Approach page <a> <p> <p> Our cash compensation range for this role is $152000yr to $232000yr in Denver amp most remote locations and $185000yr to $251000yr in San Francisco amp New York Final offer amounts are determined by multiple factors including candidate experience and expertise and may vary from the amounts listed above <p><p>
Director of Marketing Operations
Company: Protegrity
Location: USA
Posted Apr 30, 2024
Protegrity, a global data protection solutions provider, is seeking a Director of Marketing Operations to join their team. The role involves developing and maintaining marketing operations strategy, managing budget, defining business processes, and optimizing the tech stack. The ideal candidate should have 7+ years of experience in Marketing Operations, expertise in the full marketing technology stack, and strong data analysis skills. Protegrity offers a competitive compensation package, flexible work model, and a diverse, inclusive workplace.
Customer Experience and Insights Manager - Enterprise
Company: Upwork
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> Upwork $UPWK is the worlds work marketplace We serve everyone from oneperson startups to large Fortune 100 enterprises with a powerful trustdriven platform that enables companies and talent to work together in new ways that unlock their potential <p> <p> Last year more than $38 billion of work was done through Upwork by skilled professionals who are gaining more control by finding work they are passionate about and innovating their careers <p> <p> If youre an experienced CX leader whos ready to use data storytelling and insights to drive our teams to improve customers lives then this may be your dream job As the Customer Experience Manager for Upworks Enterprise Business Unit you will lead our VoC Voice of Customer function for Upworks Enterprise clients This role owns Enterprise VoC endtoend and will work with key stakeholders to ensure we are hearing from our customers throughout their journey and lifecycle You will report to the Director Customer 360 Advocacy <p> <h3> <strong> Your Responsibilities <strong> <h3> <ul> <li> <p> <strong> Drive VoC data collection <strong> Run our Enterprise NPS survey and partner with Enterprise stakeholders and product managers to identify opportunities for additional listening posts to capture customer feedback <p> <li> <li> <p> <strong> Build our VoC Enterprise journey maps <strong> Identify gaps in our understanding of the Enterprise experience to help us create a comprehensive 360° view of these customer journeys <p> <li> <li> <p> <strong> Interpret data <strong> Dive into data across sources from NPS surveys to everything in our natural language processing vendor unitQ to identify themes at scale and extrapolate statistically significant insights <p> <li> <li> <p> <strong> Communicate with strategic focus amp clarity <strong> Employ exceptional communication skills to deliver quantifiable and actionable insights to teammates leaders and stakeholders at various levels of the business <p> <li> <li> <p> <strong> Empathetic storytelling <strong> Engage both the head and heart for our Enterprise product leaders and teams providing them the understanding they need to prioritize and accomplish our customer experience goals <p> <li> <li> <p> <strong> Make prioritized and compelling recommendations <strong> Influence product roadmaps through compelling datadriven storytelling and business cases using operational customer and financial data so outputs meet business needs and are strategically aligned <p> <li> <li> <p> <strong> Learn the Enterprise product <strong> become an expert in the Upwork Enterprise product from the customers perspective <p> <li> <li> <p> <strong> Insights to action <strong> Manage our customer experience database for all Enterprise experiences ensuring all pain points are captured categorized and prioritized for product teams to take action <p> <li> <li> <p> <strong> Closedloop methodologies <strong> Educate and empower Enterprise teams to closetheloop with our customers including issue resolution prevention and communication <p> <li> <li> <p> <strong> Systems thinker <strong> Zoom out to see the big picture and dive into the details when appropriate keeping a pulse on the organizations larger strategy <p> <li> <ul> <h3> <strong> What it Takes to Catch our Eye <strong> <h3> <ul> <li> <p> Certified Customer Experience Professional CCXP <p> <li> <li> <p> Proven track record driving positive change in a complex environment <p> <li> <li> <p> Understands CX methods and tools ex NPS CES closedloop systems journey mapping <p> <li> <li> <p> Group facilitation skills with experience running internal workshops andor external customer advisory boards <p> <li> <li> <p> Experience delivering insights reports to crossfunctional teams including ability to provide direction while not having direct authority <p> <li> <li> <p> Growth mindset and a curiosity to lean into the latest industry data and best practice <p> <li> <ul> <h3> <strong> Come change how the world works <strong> <h3> <p> At Upwork youll shape talent solutions for how the world works today We are a remotefirst organization working together to create exciting remote work opportunities for a global community of professionals While we have physical offices in San Francisco and Chicago currently we also support hiring of corporate fulltime employees in 19 states in the United States Please speak with a member of our recruitment team to determine whether you are located in a state in which we are hiring corporate fulltime employees <p> <p> At the core of our vibrant culture are shared values that form the foundation of our organization These values revolve around trust risktaking customer focus and excellence Our overarching mission is to create economic opportunities so that people have better lives We foster an environment where individuals are encouraged to bring their authentic selves to work nurturing personal and professional growth through development opportunities mentorship programs and participation in Upwork Belonging Communities <p> <p> We take pride in providing exceptional benefits to our employees These include comprehensive medical insurance coverage for both you and your family unlimited paid time off a 401k plan with matching contributions 12 weeks of paid parental leave and an Employee Stock Purchase Plan To explore these benefits in detail as well as gain insights into our company values working principles and the overall employee experience we invite you to visit our <a class=fontbold underline fontbold underline fontbold underline href=httpswwwupworkcomcareerslifeatupwork rel=noopener noreferrer nofollow target=blank> Life at Upwork page <a> <p> <p> Upwork is proudly committed to recruiting and retaining a diverse and inclusive workforce As an Equal Opportunity Employer we never discriminate based on race religion color national origin gender including pregnancy childbirth or related medical condition sexual orientation gender identity gender expression age status as a protected veteran status as an individual with a disability or other applicable legally protected characteristics <p> <p> LIRemote <p><p>
Senior Software Engineer - AI
Company: Synack
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> At Synack we create technology that unleashes the best cybersecurity talent to secure our digital world <p> <p> We protect leading global organizations by reducing companies security risk and increasing their resistance to cyber attack How do we do this By utilizing the worlds best and most trusted team of ethical hackers who test through our powerful and controlled platform to deliver real security without compromise <p> <p> Backed by toptier venture capital firms including Kleiner Perkins Caufield amp Byers Microsoft and Google Ventures Synacks mission is to leverage global security talent coupled with advanced technology to help enterprises discover security vulnerabilities before they become business problems Discover the possibilities at Synack <p> <p> We are looking for a Senior Software Engineer AI where youll be spearheading the development of cuttingedge AIdriven solutions tailored for the offensive security sector This role demands a handson approach to designing developing and deploying machine learning models that address specific cybersecurity challenges enhancing our product offerings and meeting our customers critical needs Youll lead by example mentoring junior engineers and promoting a culture of technical excellence innovation and continuous improvement <p> <p> Sounds interesting Keep reading <p> <p> <strong> Please note <strong> This is a remote position based in the US We can only hire US citizens for this position due to federal government contract requirements <p> <p> <p> <p> <strong> Heres what youll do <strong> <p> <ul> <li> <p> Design implement and deliver scalable AI and machine learning solutions <p> <li> <li> <p> Develop robust AI models capable of identifying vulnerabilities automating penetration testing processes workflow optimization and enhancing threat intelligence <p> <li> <li> <p> Own and drive the endtoend development of AI product features from ideation to deployment monitoring and model management <p> <li> <li> <p> Actively participate in and contribute to design and implementation of AI solutions promoting best practices during the project lifecycle <p> <li> <li> <p> Lead technical discussions code reviews and design sessions sharing your expertise to uplift the teams capabilities <p> <li> <li> <p> Provide mentorship and support to junior engineers encouraging professional growth and development <p> <li> <li> <p> Collaborate closely with crossfunctional teams to integrate AI capabilities into broader systems and applications <p> <li> <ul> <p> <strong> Heres what youll need <strong> <p> <ul> <li> <p> 10+ years of experience in machine learning engineering with a strong foundation in statistics mathematics or a related field <p> <li> <li> <p> 3+ years of demonstrated experience in designing and implementing machine learning models and data pipelines in production environments <p> <li> <li> <p> Excellent problemsolving skills with the ability to translate complex business requirements into technical solutions <p> <li> <li> <p> Strong communication skills capable of presenting findings and insights to both technical and nontechnical audiences <p> <li> <li> <p> Proficient in Python and strong understanding of AI and machine learning algorithms and frameworks eg Tensorflow PyTorch <p> <li> <li> <p> Strong knowledge of data management systems both SQL eg PostgreSQL and NoSQL egMongoDB <p> <li> <li> <p> Demonstrated ability to work effectively in a teamoriented collaborative environment <p> <li> <ul> <p> <strong> Nice To Have <strong> <p> <ul> <li> <p> Expertise in AI and ML technologies especially Azure AI and Open AI demonstrating the ability to integrate into software solutions <p> <li> <li> <p> Interest or experience in Cyber Security <p> <li> <ul> <p> <strong> Ready to join us <strong> <p> <p> Synack is committed to embracing diversity Our people are our strength Each addition to our team is an opportunity to grow and diversify our ideas experiences and viewpoints We strive to be inclusive of Race Ethnicity Religion Sex LGBTQ+ Veterans Disabilities and Age Synack welcomes you <p> <p> As a candidate Synack cares about your privacy Please view our candidate privacy policy <a class=fontbold underline fontbold underline fontbold underline href=httpswwwsynackcomcandidateprivacynotice rel=noopener noreferrer nofollow target=blank> here <a> <p> <p> <strong> $145000 $235000 py <strong> Salary is determined by a combination of factors including location level relevant experience and skills The range displayed on each job posting reflects the minimum and maximum target for new hire salaries for the position across all US locations The compensation package for this position may also include equity and benefits For more details about our benefits please see <a class=fontbold underline fontbold underline fontbold underline href=httpssynackmybenefitslife rel=noopener noreferrer nofollow target=blank> here <a> Then for the Employer code enter <strong> synack <strong> <p><p>
Principal Engineer
Company: TeamSnap
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> <strong> 🌎 About Us <strong> <p> <p> At TeamSnap we believe when the world connects through sports the world becomes better TeamSnap is a sports and communication platform dedicated to taking the work out of play in youth sports We also believe our jobs should excite us our teammates should support us and our bosses should inspire us We empower our people to bring big ideas and tiny egos landing us on Outside Magazines list of <strong> Best Places to Work <strong> and Built Ins <strong> 100 Best RemoteFirst Places to Work <strong> <p> <p> <p> <p> TeamSnap is seeking a Principal Engineer who will report directly to the VP Engineering and Chief Architect to help define lead and drive our technological evolution As a technology leader youll shape our engineering culture in a positive direction with transparency and collaboration by mentoring leading and pairing with teams to evolve their practices and technical vision <p> <p> <p> <p> <p> <p> <strong> What youll be doing <strong> <p> <ul> <li> <p> Execute on the establishment of reference architecture and domain models <p> <li> <li> <p> Influence evolution of developer tooling and experience <p> <li> <li> <p> Help drive the definition of emerging technical and architectural strategies <p> <li> <li> <p> Supporting execution of critical projects via joining scrum teams as an additive team member ensuring the continuity of deliverables beyond scrum team interaction <p> <li> <li> <p> Ensure strong documentation of all systementerprise architecture as well as ancillary collateral such as sequence diagrams eventing orchestration layers and interoperability <p> <li> <li> <p> Define and own core KPIs to track the maintainability and effectiveness of our architecture and technology <p> <li> <li> <p> Encourage innovation creative thought and new ideassolutions <p> <li> <li> <p> Work with department leaders to identify shape and capture strategic technical work <p> <li> <li> <p> Being a strong partner and goto person for all engineering teams <p> <li> <li> <p> Contributing to engineeringwide goals priorities and improvements <p> <li> <li> <p> Consistently and systemically rallying inspiring and empowering all teams to do their best work ever <p> <li> <ul> <p> <p> <p> <strong> Whatll set you up for success <strong> <p> <ul> <li> <p> Experience leading and driving engineering departmentwide change during an evolutionary period of rapid growth and change while serving as a role model for an inclusive engineering culture <p> <li> <li> <p> Experience supporting both product and platform engineering teams as well as familiarity with our tech stack Google Cloud Platform Kubernetes Docker Terraform Datadog Elixir Typescript Golang <p> <li> <li> <p> Experience working across crossfunctional teams to foster a culture of priority setting and urgency in alignment with organizational strategy <p> <li> <li> <p> Deep experience in at least one of the following frontend web architecture mobile development platforms serverless and serverfull hybrid cloud architectures industryleading developer experience automation and tooling <p> <li> <li> <p> Youre comfortable working with nontechnical senior leaders and can convey complex technical topics to them in an approachable manner inviting collaborative discussion while also sweating and diving into the details whenever necessary getting your hands dirty and diving into code with any engineers across our department <p> <li> <li> <p> Ideally you have strong experience at Codenames we play every two weeks <p> <li> <ul> <p> <p> <p> <p> <p> Got cold feet If youre thinking you dont meet 100 of the above qualifications <strong> you should still seriously consider applying <strong> Were all humans with special talents that go beyond whats listed here <p> <p> <p> <p> <strong> Compensation <strong> <p> <p> Were committed to equitable compensation for all TeamSnappers The salary for this role starts at a minimum of $170000 inclusive of bonus and benefits Compensation is adjusted based on work experience skills certifications and geographic location Comp is highly competitive nationwide so please dont hesitate to apply <p> <p> <p> <p> <strong> 🖥 Location <strong> <p> <p> TeamSnap is a fully remote company so you need to be very comfortable working with people who arent in the same time zone as you We are always expanding but there is a small list of states we do not hire in including Alabama Alaska Delaware District of Columbia Hawaii Iowa Louisiana Mississippi Nebraska New Mexico Rhode Island South Dakota and West Virginia and while we love all parts of the world we can only hire permanent US residents at this time <p> <p> <p> <p> <strong> 🚀 Opportunities to Grow <strong> <p> <p> At TeamSnap we work hard to provide a culture of trust accountability inclusivity and boundless opportunities to grow along with the chance to make a lasting impact and have some fun while doing it <p> <p> <p> <p> <strong> 🎩 Total Rewards <strong> <p> <p> Were proud to be <a class=fontbold underline fontbold underline postingslink href=httpswwwinccommattgiventhisstartupceospolicyonworkingremotelyisgeniusanditsbasedonafamoustvshowhtml rel=noopener noreferrer nofollow target=blank> <strong> remotefirst <strong> <a> <strong> <strong> Weve been remote since 2009 long before COVID made it cool <p> <p> Unlimited PTO and paid parental leave for ALL parents not just primary or secondary <p> <p> 100 premium coverage of medicaldentalvision for you and your family <p> <p> 401K to help you invest for the future <p> <p> $1500 annual learning and development stipend <p> <p> Travel to fun locations for allcompany meetings and team events <p> <p> Generous home office allowance to set you up for success <p> <p> TeamSnap SWAG to our <a class=fontbold underline fontbold underline postingslink href=httpsteamlockersquadlockercomlockersteamsnap401580 rel=noopener noreferrer nofollow target=blank> store <a> upon starting and a $50 credit on every work anniversary thereafter <p> <p> A monthly stipend reimbursement for health amp wellness and so much more <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpsdocsgooglecompresentationd1oER8pxhc3zkKRDigScyXd6nQWVNFPV6HwATawDsGhukeditslide=idg22b26eb773f1392 rel=noopener noreferrer nofollow target=blank> TeamSnap Total Rewards <a> <p> <p> <p> <p> 🏆 <strong> Working at TeamSnap <strong> <p> <p> At TeamSnap youre not a culture fit youre a culture add Check out our <a class=fontbold underline fontbold underline postingslink href=httpswwwcanvacomdesignDAE4bjYNX4xtJEKWBDcTWpSARgrKMAoAviewutmcontent=DAE4bjYNX4amputmcampaign=designshareamputmmedium=linkamputmsource=publishsharelink1 rel=noopener noreferrer nofollow target=blank> <strong> Culture Playbook <strong> <a> and learn how we succeed at being remotefirst what makes our company so unique and how were inspired by our people our customers and our values <p> <p> <p> <p> <strong> 🧡 Inclusion and Diversity <strong> <p> <p> Creativity and innovation cant thrive when were cookiecutter images of each other Were quickly growing more diverse but theres always room for improvement We are committed to inclusion and diversity at TeamSnap and we hold ourselves accountable for building an environment where everyone feels valued If you need any disabilityrelated adaptation during the recruitment process just let us know We are an Equal Employment Opportunity Employer <p><p>
Senior Android Software Engineer
Company: Empower
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> <strong> EMPOWER OVERVIEW <strong> <p> <p> <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpempowerme rel=noopener noreferrer nofollow target=blank> Empower <a> is a highgrowth financial technology company on a mission to expand access to fair credit to give anyone in the world the opportunity to improve their financial security and mobility We dream up and launch oneofakind features that help our members get money instantly whenever they need it save for the future and rewrite their financial story Our members see Empower Cash Advance as a lifesaver Empower Automatic Savings as a gamechanger and the new Empower Thrive line of credit currently in beta launching soon as a lifeline to lowcost borrowing and the only practical path to building good credit <p> <p> <p> <p> Empower is backed by Sequoia Capital Blisce and Icon Ventures Are we the next great place to grow your impact and accelerate your career We think so <p> <p> <p> <p> Inc ranked Empower 56 in the 2023 Inc 5000 list of the fastestgrowing private companies in the US 55 in 2022 Forbes put Empower on its 2023 list of Americas Best Startup Employers Fast Company recognized the new Empower Thrive line of credit in their 2022 list of the Next Big Things in Tech <p> <p> <p> <p> <strong> THE EMPOWER WAY <strong> <p> <p> <strong> Great Expectations <strong> We come up with bold audacious goals for ourselves and go all out for impact <p> <p> <strong> Owner Mindset <strong> We give every employee latitude to act independently make smart choices and move the business forward <p> <p> <strong> Spirited Debate <strong> We love skeptics and seek counter opinions to challenge our personal assumptions and expand our view <p> <p> <strong> Customer Obsession <strong> We listen to understand empathize and create a memorable rewarding experience for our community <p> <p> <strong> Inclusive Collaboration <strong> We believe diverse teams make the best decisions and we strive to give diverse voices a seat at the table <p> <p> N <strong> o Jerks Allowed <strong> We value our relationships and take the time to build trust and connection and communicate respectfully <p> <p> <p> <p> <strong> <strong> <p> <p> <strong> WHAT EMPOWER OFFERS <strong> <p> <p> <p> <p> Competitive salary <p> <p> Generous equity package <p> <p> Full healthcare and dental benefits <p> <p> Technology expense reimbursement <p> <p> Work from anywhere <p> <p> <p> <p> <strong> JOB DESCRIPTION <strong> <p> <p> As an Android Software Engineer youll create the Android mobile app that powers the Empower customer experience Youll engage with a collaborative high powered team to develop solutions and lead product engineering on projects with a reach of millions The solutions youll build will be robust secure and easy to understand both for our users and your engineering peers Youll take end to end ownership of new features and product lines shaping work in early stages building deploying and running post deployment analysis to ensure were hitting our goals <p> <p> <p> <p> Travel for company offsites is expected at a minimum 2 times a year <p> <p> <p> <p> <p> <p> <strong> Key Responsibilities <strong> <p> <ul> <li> <p> Designing and building Android mobile apps <p> <li> <li> <p> Contribution and adherence to software engineering standards and practices <p> <li> <li> <p> Implementing secure coding standards in accordance with the Empower Secure Development Policy <p> <li> <li> <p> Perform ongoing security testing and code review to improve software security <p> <li> <li> <p> Meeting sprint goals <p> <li> <li> <p> Leading andor supporting feature specification activities Product Engineering <p> <li> <li> <p> Monitoring the performance of the Empower mobile app and applying corrective action through bug fixing and general improvement <p> <li> <li> <p> Minimizing defects and improving reliability through Development of automated tests manual test validation development of fit for purpose architecture and code contributing to PRs <p> <li> <li> <p> Developing and maintaining the Android app build pipeline <p> <li> <li> <p> Publishing the App to the Google Play Store <p> <li> <li> <p> Collaborating crossfunctionally to define design and ship new features that create customer and business value <p> <li> <li> <p> Playing an active role in advising and collaborating with design and product to flesh out the specifications of each epic <p> <li> <li> <p> Writing engineering specs including acceptance criteria and server contracts <p> <li> <li> <p> Grooming stories for upcoming sprints <p> <li> <li> <p> Maximising effective development and identifying new technology opportunities by Keeping across Android development announcements being across community best practice discovering and evaluating new technologies <p> <li> <ul> <p> <p> <p> <strong> Candidate Qualifications <strong> <p> <ul> <li> <p> Bachelor degree or greater within Computer Science Software Engineering or a related subject <p> <li> <li> <p> 5+ years developing consumer facing Android apps <p> <li> <li> <p> Working experience in Kotlin and Android UI Frameworks <p> <li> <ul> <p> <p> <p> <p> <p> At Empower we hire for people that push themselves to understand others and seek out ways to challenge their personal assumptions Our hope is that by fostering such an environment we strengthen our business and relationships by putting people first We are committed to building a diverse inclusive and equitable workspace where everyone regardless of age education ethnicity gender sexual orientation or any personal characteristics feels like they belong Even if your experience doesnt exactly match up to our job description you should feel empowered to apply regardless <p><p>
Account Executive (Manager/Director of Strategic Accounts)
Company: OfferFit
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> <strong> Position Overview <strong> <p> <p> Were currently looking for a driven Account Executive ManagerDirector of Strategic Accounts to join our team In this role youll be responsible for winning and growing business for OfferFit by owning new and existing senior customer relationships <p> <p> <strong> In particular you will <strong> <p> <ul> <li> <p> Working closely with our business development amp marketing teams to create leads <p> <li> <li> <p> Lead discussions with potential new OfferFit customers <p> <li> <li> <p> Work with current and future OfferFit customers to determine the highestimpact applications of our AIsolution <p> <li> <li> <p> Participate in OfferFit POV motion to ensure they progress successfully working closely with OfferFits technical Implementation team <p> <li> <li> <p> Build amp own relationships with senior leaders at OfferFits customer companies eg CMOs CIOs <p> <li> <li> <p> Communicate customer needs to OfferFits product amp marketing teams ensuring a customercentric product roadmap <p> <li> <ul> <p> <strong> Why is it great <strong> <p> <ul> <li> <p> Be the face of the company working alongside our customers to help them succeed <p> <li> <li> <p> Sell a product with strong productmarket fit the pain of manual experimentation is a real pain point for marketers leading to a high level of enthusiasm for our products <p> <li> <li> <p> Get strong support from leadership OfferFit prioritizes sales helping your team succeed will be a true priority for the CEO and other Sales leadership team members <p> <li> <li> <p> Lead the AI transformation happening in marketing technology today OfferFit is at the forefront so youll be in the middle of the action <p> <li> <li> <p> Join OfferFits fastpaced supportive and professional team We make sure all of our team members are empowered and receive great mentorship and coaching <p> <li> <ul> <p> <strong> Whos a fit <strong> <p> <ul> <li> <p> Executionfocused leader you can structure a plan align stakeholders and see it through to execution <p> <li> <li> <p> People person you build trustbased relationships with internal team members and external partners and combine empathy with a willingness to have direct challenging conversations <p> <li> <li> <p> Processdriven you can create scalable frameworks to optimize the success of business outcomes <p> <li> <li> <p> Entrepreneurial you take initiative work around obstacles and always seek creative ways to get to the next level <p> <li> <li> <p> Technology enthusiast you are passionate about new technologies and their potential to impact businessasusual <p> <li> <li> <p> Clear communicator you are able to express yourself clearly and persuasively both in writing and speech <p> <li> <li> <p> Sales expert you have a history of enterprise sales and are wellversed in SPIN selling amp MEDDPICC qualification methodology <p> <li> <ul> <p> The base salary range for this position in the United States is $81000$142000 per year plus eligibility for additional commissionbonus ranging $91000$162000 with an overall OTE of $172000$305000 ability to earn more based on sales goals Eligibility for an additional end of year performance bonus commissions when applicable andor equity options may be provided as part of the compensation package in addition to a full range of medical financial andor other benefits depending on the position offered For nonUS based candidates base pay and overall compensation packages will be adjusted based on location Applicants should apply via OfferFits internal or external careers site <p> <p> <strong> OfferFit Benefits and Perks <strong> <p> <ul> <li> <p> Generous PTO starting at 25 days PTO per year and Parental leave policy 12 weeks paid <p> <li> <li> <p> 100 remote work environment with flexible hours <p> <li> <li> <p> Quarterly gatherings where we meet in person in a different city to work together bond as a team and celebrate our progress <p> <li> <li> <p> Weekly team events lunch and learns trivia virtual escape rooms town hall and team health barometer meetings <p> <li> <li> <p> Ability to learn and develop from an experienced leadership team exAmazon McKinsey BCG and IBM among others who are focused on building a talented diverse and inclusive tea <p> <li> <li> <p> Dedication to building a strong culture eg team resource groups weekly recognitions major life event celebrations mental healthsustainability days off etc <p> <li> <li> <p> US Only Competitive benefits major medical vision dental and LTD and 401K matching program <p> <li> <ul><p>