Full Time Jobs in London ON

Positions 1,344,328 Updated daily

Looking for Full Time jobs in London ON? Browse our curated listings with transparent salary information to find the perfect Full Time position in the London ON area.

"Invite Only" IBM Consulting - Cyber First Consultant June Start

Company: IBM

Location: GB London

Posted Feb 26, 2024

<div class=jddescription datafield=description> <span class=showjobdescr style=fontweight bold> Introduction <span> <span class=showjobdescr> <span> <br> Information and Data are some of the most important organizational assets in todays businesses As a Security Consultant you will be a key advisor for IBMs clients analyzing business requirements to design and implement the best security solutions for their needs You will apply your technical skills to find the balance between enabling and securing the clients organization with the cognitive solutions that are making IBM the fastest growing enterprise security business in the world <br> <span class=showjobdescr style=fontweight bold> <span> <br> <span class=showjobdescr style=fontweight bold> Your Role and Responsibilities <span> <span class=showjobdescr> <span> <br> <span style=fontsize14px> <strong> You are only eligible to apply for this role if you arehave been part of the UK Government National Cyber Security Centre Cyber First Programme <p> June 2024 Starts <p> <strong> <span> <p> From day one youll join a dynamic graduate community You can explore a vast array of inclusive organizations and programs that promote the IBM values of social and corporate responsibility Living and working in a culture built on strong ethical values and business integrity making a difference in the world <p> <p> Our clients technical and business needs are constantly evolving Were hiring inspired talented individuals eager to apply their knowledge and perspective to challenging work that evolves industries and our world We prioritize ongoing learning development of technical skills and continuous personal growth all grounded in a culture of coaching and education <p> <p> With excellent people skills you will bridge the gap between users and technology Designing and building creative customer experiences using realtime analytics and cloud technologies infusing cognition into our clients enterprises building mobile and web apps reinventing the digital world of the future <p> <p> As an Associate Technology Consultant you will be infusing cognitive and evolving technologies into our clients businesses and modernising them through cloud environments <p> <p> In your first two years youll move between different projects partnering with a variety of household names and making a difference to everyday life <p> <p> You will work with some of the worlds leading technology specialists in Digital Cognitive and Cloud Learning from their experience and working with cutting edge technologies taking on more challenges and responsibilities as you grow your career <p> <p> You will have a dedicated Consulting Associates Manager giving you the confidence to make the very best of every opportunity and supporting your accelerated career growth You will be empowered to become who you want to be <br> <span class=showjobdescr style=fontweight bold> <span> <br> <span class=showjobdescr style=fontweight bold> Required Technical and Professional Expertise <span> <span class=showjobdescr> <span> <br> <span class=questionInput qbchildren=> <span style=color rgb18 18 18 fontfamily Tahoma Geneva sansserif fontsize 14px> Predicted a 21 Bachelors Degree or achieved <br> Part of the UK Government National Cyber Security Cyber First Programme <span> <span> <p> <p> <span class=showjobdescr style=fontweight bold> <span> <br> <span class=showjobdescr style=fontweight bold> Preferred Technical and Professional Expertise <span> <span class=showjobdescr> <span> <br> <p><div>

Finance Systems Analyst

Company: Monzo

Location: London, England, United Kingdom

Posted Feb 28, 2024

<p>📍London Cardiff or Remote UK | 💰£65000 nbsp £72000 ➕ | <a href=httpsmonzocomcareers>Benefits<a> | <a href=httpswwwyoutubecomwatchv=tDAT6VxoqQM>Hear from the team<a> ✨<br><br><strong>About usnbsp<strong><p> <p>We’re here to make money work for everyone and were doing things differently For too long banking has been obtuse complex and opaque<p> <p>We want to change that and build a bank with everyone for everyone Our amazing community suggests features test the app and give us constant feedback so we can build something everyone loves<p> <p>Were focused on solving problems rather than selling financial products We want to make the world a better place and change peoples lives through Monzo<p> <p><strong>About the role<br><strong>We are looking for a <strong>Finance System Analyst<strong> to join Monzo’s Finance function to be responsible for supporting delivery of and maintaining systems for our core accounting regulatory reporting treasury and financial planning amp analysis teams<p> <p>You’ll be supporting vendor selection configuration maintenance and administration of third party systems to ensure Monzo’s Finance function maximises the value we get out of our financial softwarenbsp<p> <p><strong>Our systems<strong><br>We currently utilise the following systems across our Finance function You will be responsible for ensuring these systems are operating effectively and will also help set out the future of these and any new systems<p> <ul> <li>NetSuite as our current accounting system General Ledger<li> <li>SAP as our future Enterprise Resource Planning ERP system<li> <li>Anaplan as our financial planning and forecasting system<li> <li>MORS Software Treasury Management System and Asset amp Liability Management<li> <li>Vermeg Regulatory Reportingnbsp<li> <li>Lightyear invoice processing<li> <li>Expensify expense management<li> <ul> <p><strong>Role Responsibilities<strong><strong><br><strong>You will be responsible fornbsp<p> <ul> <li>Maintaining our third party systems typically Software as a Service including user access configuration changes managing upgrades and being the first point of contact for any vendor related issues<li> <li>Support the selection of any new systems vendors across the finance function working closely with the finance and programme management teams to help ensure we select the right vendors<li> <li>Support the implementation of any new systems across finance ensuring they are appropriately set up and configured to support our financial business processes<li> <li>Monitoring performance KPIs troubleshooting and resolving any problems with existing software including updates configuration changes and upgrades<li> <li>Support Finance leadership on relationship management with vendors ensuring we are getting the support we need and that project work is on track<li> <li>Work closely with our engineering colleagues to ensuring topnotch data quality and help monitor data flows between systems<li> <ul> <p><strong>You should apply if<strong><p> <ul> <li>Indepth knowledge of at least one accounting ERP system and operating principlesnbsp Ideally experience of implementing and supporting SAP<li> <li>Experience working within in banking finance and supporting financial business processes<li> <li>Experience working closely with software vendors software engineers and data teams<li> <li>Experience working closely with embedded data analysts scientists<li> <li>Proficient with SQL and data visualisation tooling such as Looker Tableau etc<li> <li>Experience designing and implementing technical infrastructure for systems support and monitoring<li> <li>Nice to haves<li> <li>A bachelors or vocational degree in information systems computing software engineering or a related field<li> <li>Some programming experience familiarity with at least one programming language go lang python ruby<li> <li>Used to agile ways of working Kanban Scrum tracked in JIRA or Trello<li> <ul> <p><strong>Nice to haves<strong><p> <ul> <li>Degree in information systems computing software engineering or a related field<li> <li>Some programming experience familiarity with at least one programming language go lang python ruby<li> <li>Used to agile ways of working Kanban Scrum tracked in JIRA or Trello<li> <ul> <p><strong>The interview process<strong><p> <p>Our interview process involves 2 main stagesnbsp<p> <ul> <li>Phone call with recruiter<li> <li>Technical interview with Engineering Director 45 min<li> <li>Monzo behavioural interview with hiring manager and their manager 45 min<li> <ul> <p>Our average process takes around 34 weeks but we will always work around your availability You will have the chance to speak to our recruitment team at various points during your process but if you do have any specific questions ahead of this please contact us on businesshiringmonzocom<p> <p><strong>What’s in it for you<strong><strong><br><strong><strong><br><strong><strong> <strong><strong>💰 <strong>£65000 nbsp £72000 depending on experience ➕ plus stock options amp benefitsnbsp<p> <p>📍This role can be based in our London or Cardiff office but were open to distributed working within the UK with ad hoc meetings in LondonCardiff<p> <p>⏰ We offer flexible working hours and trust you to work enough hours to do your job well at times that suit you and your team<p> <p>📚 Learning budget of £1000 a year for books training courses and conferences<p> <p>➕ And much more see our full list of benefits <a href=httpsmonzocomcareers><strong>here<strong><a><p> <p>If you prefer to work parttime well make this happen whenever we can whether this is to help you meet other commitments or strike a great worklife balance<p> <p><strong>Equal Opportunity Statement<strong><p> <p><strong>We are actively creating an equitable environment for every Monzonaut to thrive<strong><p> <p>Diversity and inclusion are a priority for us and we are making sure we have lots of support for all of our people to grow at Monzo At Monzo embracing diversity in all of its forms and fostering an inclusive environment for all people to do the best work of their lives with us This is integral to our mission of making money work for everyone You can read more in our <a href=httpsmonzocomblogdiversityandinclusion><strong>blog<strong><a> 2022 <a href=httpsmonzocomblog2022diversityandinclusionreport><strong>Diversity and Inclusion Report<strong><a> and 2023 <a href=httpsmonzocombloganupdateonourgenderpaygap2023><strong>Gender Pay Gap Report<strong><a><p> <p>We’re an equal opportunity employer All applicants will be considered for employment without attention to age ethnicity religion sex sexual orientation gender identity family or parental status national origin or veteran neurodiversity or disability status<p> <p>LINZ1 LIRemote<p><br><br>Please mention the word OUTDO and tag RNTIuMTYwLjQ0LjY0 when applying to show you read the job post completely RNTIuMTYwLjQ0LjY0 This is a beta feature to avoid spam applicants Companies can search these words to find applicants that read this and see theyre human

Fraud and AML Analyst UK

Company: Taptap Send

Location: London, UK

Posted Feb 21, 2024

<p><b style=fontsize 18px>Our Mission <b><p><p>Reduce inequity by helping immigrants move money home by becoming the leading crossborder fintech for immigrants<p><p><br><p><p><b style=fontsize 18px>The Team<b><p><p>gt Founded by Harvard grads 3rdtime founders also founded Segovia successful exit and GiveDirectly gt300M revenue fastestgrowing NGO<p><p>gt Top performers from top and varied organizations eg Bain Bolt Google McKinsey SafeBoda Uber Zipline we like moving fast and we hire people that do as well<p><p>gt Driven by mission guided by values see below – in deed not just word<p><p>gt Team as global as the mission gt30 languages from 25 countries ie if you’re interested in learning to make Chicken Moambe we’re the place<p><p><br><p><p><b style=fontsize 18px>About Us<b><p><p>Taptap Send is backed by top VCs Spark Canaan Reid Hoffman Breyer Capital etc rapidly growing and a great place for those looking for both impact and a fastpaced tech startup environmentnbsp Read more about the journey in Reid Hoffman’s <a href=httpswwwlinkedincompulsesegoviasnextstepreidhoffman class=postingslink>words<a> or TechCrunch <a href=httpstechcrunchcom20210624taptapsendgets134mforanofeemoneytransferserviceaimedatpriceconsciousemergingmarketusersguccounter=1 class=postingslink>article<a><p><p><br><p><p>Launched in 2019 Taptap is tapping into a transformative shift in global finance from banks to phones While this has affected wealthier countries as well it has been nothing short of a revolution for the emerging markets where the overwhelming majority of population had been unable to access digital finance previouslynbsp Its first product Taptap Send allows immigrants to send money home instantly and with no fee saving money in the process With a formal market size of gt700B alone we’ve got a lot more saving to do for our users And that’s just the beginning…<p><p><br><p><p><b style=fontsize 18px>Our Investors<b><p><p>Spark Capital Canaan Reid Hoffman Breyer Capital Jim Breyer Unbound Shravin Mittal Wamda Fadi Ghandour Firstminute Capital Slow Ventures Sam Lessin Helios Partners Souleymane Ba Crossbeam Ventures Ali Hamed Nikesh Arora Samih Toukan and many other contextspecific angels<p><p><br><p><p><i style=fontsize 15px>We charge fees for transfers on fixed exchange rate corridors eg XOF XAF<i><p><p><br><p><p><b style=fontsize 18px>The Role<b><p><p><br><p><p><span style=fontsize 16px>Taptap Send is seeking a compliance and fraud analyst with 12 years of experience to carry out first line financial crime reviews while a member of our team is on paternity leave You will carry out in depth investigations into potential fraud money laundering and carry out enhanced due diligence on customers<span><p><p><br><p><p><span style=fontsize 16px>The role is fulltime and based in the UK and remote arrangements are available You will work with the Fraud Team Lead and the wider Taptap Send financial crime team to implement the compliance and fraud program for Taptap Send’s global operationsnbsp<span><p><p><br><p><p><span style=fontsize 16px>As part of our first line of defence the analyst will join the team that tackles financial crime and conducts indepth investigations into suspected scams and possible money laundering<span><p>n<p><p><br><p><b>You will<b><ul><li>Use a combination of our technology and thirdparty software to evaluate suspicious or potentially fraudulent transactions and gather information to drive decisionmaking<li><li>Review potentially sanctioned customers or recipients and review customers that might be politically exposed<li><li>Escalate suspicious activity to the second line of defence and being able to rationalise and defend your decisions as needed<li><li>Perform diligence on customers to ensure that we understand who they are and their risk profile<li><li>Assist with and responding to information requests from commercial partners<li><li>Be willing to work some weekends with time off in lieu<li><ul><p><br><p><b>You have<b><ul><li>12 years experience in a regulated financial institution in a compliance or compliancerelated role<li><li>An interest in using technology to address fraud and compliance issues<li><li>Experience with compliance systems transaction monitoring sanction screening etc<li><li>Attention to detail while still seeing the bigger picture<li><li>The initiative to work independently to pursue your analysis<li><li>Good communication skills and the ability to clearly express opinions and concerns<li><li>A willingness to work flexible hours<li><li>Proficiency in English required and preferably another European language<li><li>The right to work in the country you are applying to work in<li><ul><p><br><p><p>n<p><a href=httpswwwtaptapsendcomourvalues style=fontsize 24px class=postingslink>Taptap Valuesnbsp<a><p><p>Impact first <p><p>Team next <p><p>Accept reality <p><p>Propose solutions <p><p>Win with grit <p><p>Be proactively candid with yourself and others <p><p>Love the particular <p><p>Own it <p><p>Create positive energy <p><p>Maybe even have fun<p><p><br><p><p><span style=fontsize 18px>Equal Opportunity Employer<span><p><p><br><p><p>Taptap Send is an equal opportunity employer dedicated to building an inclusive and diverse workforce All employment decisions are decided on the basis of qualifications experience and business need We strongly encourage applications who are members of underrepresented communities to apply<p><p><br><p><p>If you require reasonable adjustments to be made during the recruitment process please do not hesitate to let us know Any information you provide us in this respect will only be used to accommodate your requirements<p><p><br><p><p><i>Note we recognize imposter syndrome is real any candidate that does not perfectly fit every characteristic of this role is still strongly encouraged to applynbspnbsp<i><p><br><br>Please mention the word EVENTFUL and tag RNTIuMTYwLjQ0LjY0 when applying to show you read the job post completely RNTIuMTYwLjQ0LjY0 This is a beta feature to avoid spam applicants Companies can search these words to find applicants that read this and see theyre human

Back End Engineer

Company: Collectiv Food

Location: London, England, United Kingdom

Posted Feb 17, 2024

<h3>Back End Engineer Junior<h3> <p><strong>£30k | Permanentnbsp | Reporting to Engineering Manager<strong><p> <p>Collectiv Food is looking for a talented Junior Back End engineer to join an exciting fastpaced teamnbsp<p> <p>Located in White City West London you will join a growing collaborative team that encourages innovation and contribution from everyone<p> <p>As part of a multidisciplinary team you will be using the latest technology to produce scalable services helping to solve complex problems that will have a real impact on the success of businesses across the foodservice industry<p> <h4>What you’ll be doing<h4> <p>You will be working within an Agile software development team with some of the following technologies Net 60 C Typescript AWS Suite ECS DynamoDB Lambda Elasticsearch SQS and SNS creating services that power our revolutionary web and mobile applications<p> <ul> <li>Crafting reusable code to implement new features and support live products<li> <li>Ensure unit and automated test coverage is achieved<li> <li>Optimisation of applications for speed and scalability<li> <li>AgileScrum development includingnbsp<li> <ul> <li>Design reviews and code reviews<li> <li>Active involvement in refinement and planning sessions<li> <li>Working well in a team context adapting to and influencing team practices<li> <ul> <li>Contributing to wider business goals ensuring the availability security and scalability of its platforms<li> <ul> <h4>Skills and Requirements<h4> <ul> <li>Experience with either C Javascript or Typescript or a similar language<li> <li>Familiar with principles such as SOLID TDD YAGNI and KISS — even better if you practice most of them<li> <li>Aware of best practices for application lifecycle management CICD Unit test monitoring<li> <ul> <h4>Added bonuses or the cherries on top<h4> <ul> <li>Experience building online services and APIs<li> <li>Experience with Net C or NodeJS Typescript or Javascript<li> <li>Experience working with cloud technologies such as AWS or Azure<li> <li>Experience with infrastructure as code Terraform Pulumi<li> <li>Familiar with SQL and NoSQL database development<li> <li>Secure authorisation eg OAuth use of JWT etc<li> <ul> <p> The qualifications and experiences above are a guide and we would still love to hear from you if you believe you have the necessary skills to excel with us<p> <h4>What youll getnbsp<h4> <ul> <li>Competitive salary with industrymatching pay reviews<li> <li>EMI Stock Options for every employee<li> <li>NEST Pension option to choose greener funds<li> <li>£1000 per year for you to spend on what matters to <em>you <em>from learning and development to healthcare to mental wellbeing to gym membership you choose<li> <li>25 days plus a day for your birthday wedding day and moving day as well as up to 1 day per quarter for you to volunteer<li> <li>Sabbatical offered after 3 years service<li> <li>Highspec laptop and equipment<li> <li>Flexible working<li> <li>Hybrid remote and office based working We trust you to get the work done start late finish late we don’t mind You are required to be on site Tuesday and Thursday White City location<li> <li>Great exposure and ability to impact a fastgrowing missiondriven food startup<li> <ul> <p>If you need sponsorship to have the right to work fulltime in the UK please let us knownbsp<p> <h4>What you can expect from our recruitment process<h4> <ul> <li>Stage 1 30minute phone interview with our Engineering Manager<li> <li>Stage 2 15 hour technical interviewnbsp<li> <li>Final stage 45 minute interview with VP of Engineering followed by a 15 minute meet the team finalised by a 30 minute call with HR<li> <ul> <p>nbsp<p> <p><strong>Why Collectiv Food<strong><p> <p>Collectiv Food is a next generation food and drink supply business leading the transition to sustainable transparent and fair supply chain for Europe’s professional kitchens Its innovative delivery model enables it to offer marketbeating prices and a reliable service all underpinned by a commitment to sustainability Founded in 2018 we are based in West London and supported by industry experts and leading venture investors such as VNV Global Octopus Norrsken VC VVNP and Partech<p> <p>nbsp<p> <p><strong>Collectiv Food – Our Commitment to fostering a sense of Belonging<strong><p> <p><strong>People and Food United in their Individuality<strong><p> <p>Collectiv Food is an equal opportunity employer We are a diverse bunch of people who are committed to cultivating a welcoming culture of inclusion and equality We see the potential in everyone and value the importance that different backgrounds experiences and ways of thinking can have in igniting innovation and propelling our business forwardnbsp<p> <p>If you share our values love of food and vision to lead the transition to a sustainable fair and transparent food supply chain then we’d love to hear from you and encourage your application Protecting your privacy and the security of your data is a top priority for us at Collectiv Food Please consult our Privacy Notice to know more about how we collect use and transfer the personal data of our candidates<p> <h3><br><br><br><br><h3><br><br>Please mention the word COMMEND and tag RNTIuMTYwLjExMS41Ng== when applying to show you read the job post completely RNTIuMTYwLjExMS41Ng== This is a beta feature to avoid spam applicants Companies can search these words to find applicants that read this and see theyre human

Restart Your Technical Career – Full Stack Engineer – (Tech Re-Entry)

Company: IBM

Location: GB London

Posted Feb 27, 2024

<div class=jddescription datafield=description> <span class=showjobdescr style=fontweight bold> Introduction <span> <span class=showjobdescr> <span> <br> In this role youll work in one of our IBM Consulting Client Innovation Centers Delivery Centers where we deliver deep technical and industry expertise to a wide range of public and private sector clients around the world​ Our delivery centers offer our clients locally based skills and technical expertise to drive innovation and adoption of new technology <p> A career in IBM Consulting is rooted by longterm relationships and close collaboration with clients across the globe <p> <p> Youll work with visionaries across multiple industries to improve the hybrid cloud and AI journey for the most innovative and valuable companies in the world Your ability to accelerate impact and make meaningful change for your clients is enabled by our strategic partner ecosystem and our robust technology platforms across the IBM portfolio including Software and Red Hat <p> <p> Curiosity and a constant quest for knowledge serve as the foundation to success in IBM Consulting In your role youll be encouraged to challenge the norm investigate ideas outside of your role and come up with creative solutions resulting in ground breaking impact for a wide network of clients Our culture of evolution and empathy centers on longterm career growth and development opportunities in an environment that embraces your unique skills and experience <br> <span class=showjobdescr style=fontweight bold> <span> <br> <span class=showjobdescr style=fontweight bold> Your Role and Responsibilities <span> <span class=showjobdescr> <span> <br> Full Stack Engineer Tech ReEntry <p> <p> Are you ready for a career change that can take you to new heights in the dynamic world of technology Look no further <p> <p> The IBM CIC are introducing an exciting career opportunity to join our Software Development Team via the Tech Entry Scheme <p> <p> We are thrilled to offer this exceptional opportunity for individuals transitioning into IT and software development even without a formal degree At IBM CIC we believe that passion dedication and a willingness to learn are the driving forces being success in this everevolving industry We understand that some of the most talented individuals may not have pursued the traditional educational paths in IT or may have done and have IT industry experience but are in a position that may not be rewarding enough and thats why we are committed to providing a comprehensive training pathway to kickstart your career <p> <p> Why consider a career in IT and software development with us <p> <p> Training will be provided We strongly believe in investing in our employees growth and development Even if you dont have a technical background we will offer an extensive training program that covers the essential skills and knowledge needed to thrive in IT and software development This training will initially involve learning both front and backend software languages and Cloud technologies across the following disciplines Java JavaScript TypeScript Git amp GitHub ReactVuejs AWSAzure and as your career evolves you will gain further experience across networking infrastructure cyber security AI and cloud computing Our team of experienced professionals will guide you every step of the way ensuring a smooth transition into this field <br> Diverse and challenging projects As a member of our team you will have the opportunity to work on a wide range of projects that span different industries and sectors From developing cutting edge applications to creating innovative solutions you will be the forefront of driving technical advancements and making a tangible impact <br> Collaborative and supportive work environment We foster a collaborative culture that values teamwork open communication and knowledge sharing Youll be part of a supportive community where your ideas are encouraged and your growth is nurtured Our team members come from diverse backgrounds bringing unique perspectives that enrich our work and create an inclusive atmosphere <br> Career progression and growth We are committed to your longterm success As you build your skills and gain experience various opportunities for career progression and growth within the company will become available We believe in recognizing and rewarding talent providing a clear path for advancement based on your abilities and achievements <p> <p> Eligibility Requirements <br> To be eligible for this opportunity you need to have had a minimum of 12 month out of the workplace As an equal opportunities employer we welcome applications from individuals of all backgrounds However for you to be eligible for this role you must have the valid right to work in the UK <p> <p> Your first 6 weeks will cover technical skills development and introduce you to your industry and project team so you are ready to join a Software Engineering team from week 7 onwards <br> The role will be in a Public Sector account and allow you to utilise your experience and industry knowledge to help problem solve devise solutions and build new technology to advance industry processes <p> <p> If you are looking for a career change that offers endless possibilities where you can learn grow and make a meaningful impact this is the opportunity youve been waiting for <p> <p> Ready to take the first step toward a new and exciting future in IT and software development Apply today and let us help you unlock your potential <br> <span class=showjobdescr style=fontweight bold> <span> <br> <span class=showjobdescr style=fontweight bold> Required Technical and Professional Expertise <span> <span class=showjobdescr> <span> <p> <ul> <li> Vue Js <li> <li> Web Development HTML CSS Node JS JavaScript <li> <li> Knowledge of C NET particularly ASPNET Core <li> <li> Experience with HTML JavaScript and web development frameworksVueJS <li> <li> Proven experience with software design and objectoriented development methodologies <li> <li> Knowledge of both relational and NoSQL databases <li> <li> Knowledge of cloud Azure preferred <li> <li> Strong experience with web services development REST <li> <li> Knowledge of objectoriented programming MVC MVVM <li> <li> Design patterns and SOLID principles <li> <ul> <p> As an equal opportunities employer we welcome applications from individuals of all backgrounds However for you to be eligible for this role you must have the valid right to work in the UK Unfortunately we do not offer visa sponsorship and have no future plans to do so <br> <span class=showjobdescr style=fontweight bold> <span> <br> <span class=showjobdescr style=fontweight bold> Preferred Technical and Professional Expertise <span> <span class=showjobdescr> <span> <p> <ul> <li> Vue Js <li> <li> Web Development HTML CSS Node JS JavaScript <li> <li> Knowledge of C NET particularly ASPNET Core <li> <ul><div>

Fraud and AML Analyst UK

Company: Taptap Send

Location: London, UK

Posted Feb 21, 2024

Taptap Send is a fintech company that aims to reduce inequity by helping immigrants send money home. They are backed by top VCs and have a global team with diverse backgrounds. The company is seeking a compliance and fraud analyst to join their team.

Junior Scheduler

Company: Seamount

Location: London, England, United Kingdom

Posted Feb 28, 2024

Be Grizzlee, an inclusive and ambitious creative studio, is seeking a Junior Scheduler for a permanent, hybrid role in London. The role offers an excellent opportunity to develop skills in post-production, working closely with Producers and Artists. The Junior Scheduler will assist with sourcing and booking freelancers, maintaining relationships, updating software, and supporting Producers with crew requirements. The ideal candidate is highly motivated, proactive, and has excellent communication skills. Benefits include continued learning, life insurance, family care leave, well-being support, and a great work environment.

Senior Events Marketing Coordinator UK

Company: Degreed

Location: London, England, United Kingdom

Posted Feb 24, 2024

<p>Degreed is seeking a rockstar Senior Event Marketing Coordinator to join our Marketing team This job is fastpaced and critically important to the Global Event team You’ll have the opportunity to work on inperson amp virtual events webinars marketing campaigns and newsletters You will work closely with the Global Event team to construct and organize all the logistics of planning toptier events<p> <p>This role is at the heart of Degreeds Global Event team offering a dynamic and fastpaced opportunity to spearhead both virtual and inperson B2B events As a Senior Event Marketing Coordinator youll be deeply involved in every aspect of event planning and execution from initial research and planning to the final stages of analyzing event success Your days will be filled with various tasks including negotiating with venues and vendors coordinating logistics and collaborating with crossfunctional teams to ensure every event is a success This description is designed to outline primary duties and is not limited to only these tasks flexibility and adaptability are key <p> <p>This position will report to the Senior Manager of Global Events<p> <p><strong>Day In The Life<strong><p> <ul> <li>Spearhead endtoend initiatives to ensure the successful execution of virtual amp inperson B2B events Degreedhosted and thirdparty industry events<li> <li>Research plan and organize events in accordance with financial and time parameters and regional goals<li> <li>Research negotiate and book appropriate venues and vendors or tech<li> <li>Oversee technical production FampB housing creative design<li> <li>Schedule and organize time slots and speakers for eventnbsp<li> <li>Arrange promotional items shipping FedEx Amazon<li> <li>Update and maintain pre and postevent registration lists and work with the Analytics team to report data metrics<li> <li>Track event performance including pipeline generation and return on investment<li> <li>Collaborate with the sales and sales development team in developing engaging outreach strategies<li> <li>Assist other event coordinators with all aspects of logistical planning and execution of trade shows conferences client and proprietary events<li> <li>Collaborate with crossfunctional teams Sales Client Experience Digital Marketing Content Email Brand and Productnbsp<li> <li>Work with swag contact to ensure orders are processed smoothly for events<li> <li>Track and reconcile expenses Work closely with the finance team on all marketing invoices and expenses<li> <li>Assist with miscellaneous projects and tasksnbsp<li> <ul> <p>nbsp<p> <p><strong>Who You Are<strong><p> <ul> <li>A detailoriented highly organized individual with a passion for event planning and a knack for managing multiple tasks efficientlynbsp<li> <li>You have a strong background in B2B event coordination particularly within the SaaS industry and possess excellent communication and interpersonal skillsnbsp<li> <li>You thrive in a team environment but are also capable of working independently and handling the pressures that come with event planning<li> <ul> <p><strong>What Will Set You Apart<strong><p> <ul> <li>Bachelors degree in Marketing Communications or relevant field<li> <li>34 years of experience in coordinating and managing both virtual amp inperson events and webinars for B2B SaaS companies<li> <li>Proficiency in tools such as Zoom Microsoft Teams Slack Asana Google Suite Bizzabo Hubspot and Salesforce or similar platforms<li> <li>Strong capabilities in Excel and data management<li> <li>Exceptional administrative organizational and detailoriented skills<li> <li>Excellent interpersonal and communication skills with the ability to stay calm under pressure<li> <li>Flexibility to work weekends early mornings and evenings as required with approximately 15 travel<li> <ul> <p>nbsp<p> <p><em>LIRemote<em><br><em>100 Remote<em><p><br><br>Please mention the word SUPER and tag RNTIuMTYwLjQ0LjY0 when applying to show you read the job post completely RNTIuMTYwLjQ0LjY0 This is a beta feature to avoid spam applicants Companies can search these words to find applicants that read this and see theyre human

Back End Engineer

Company: Collectiv Food

Location: London, England, United Kingdom

Posted Feb 17, 2024

<h3>Back End Engineer Junior<h3> <p><strong>£30k | Permanentnbsp | Reporting to Engineering Manager<strong><p> <p>Collectiv Food is looking for a talented Junior Back End engineer to join an exciting fastpaced teamnbsp<p> <p>Located in White City West London you will join a growing collaborative team that encourages innovation and contribution from everyone<p> <p>As part of a multidisciplinary team you will be using the latest technology to produce scalable services helping to solve complex problems that will have a real impact on the success of businesses across the foodservice industry<p> <h4>What you’ll be doing<h4> <p>You will be working within an Agile software development team with some of the following technologies Net 60 C Typescript AWS Suite ECS DynamoDB Lambda Elasticsearch SQS and SNS creating services that power our revolutionary web and mobile applications<p> <ul> <li>Crafting reusable code to implement new features and support live products<li> <li>Ensure unit and automated test coverage is achieved<li> <li>Optimisation of applications for speed and scalability<li> <li>AgileScrum development includingnbsp<li> <ul> <li>Design reviews and code reviews<li> <li>Active involvement in refinement and planning sessions<li> <li>Working well in a team context adapting to and influencing team practices<li> <ul> <li>Contributing to wider business goals ensuring the availability security and scalability of its platforms<li> <ul> <h4>Skills and Requirements<h4> <ul> <li>Experience with either C Javascript or Typescript or a similar language<li> <li>Familiar with principles such as SOLID TDD YAGNI and KISS — even better if you practice most of them<li> <li>Aware of best practices for application lifecycle management CICD Unit test monitoring<li> <ul> <h4>Added bonuses or the cherries on top<h4> <ul> <li>Experience building online services and APIs<li> <li>Experience with Net C or NodeJS Typescript or Javascript<li> <li>Experience working with cloud technologies such as AWS or Azure<li> <li>Experience with infrastructure as code Terraform Pulumi<li> <li>Familiar with SQL and NoSQL database development<li> <li>Secure authorisation eg OAuth use of JWT etc<li> <ul> <p> The qualifications and experiences above are a guide and we would still love to hear from you if you believe you have the necessary skills to excel with us<p> <h4>What youll getnbsp<h4> <ul> <li>Competitive salary with industrymatching pay reviews<li> <li>EMI Stock Options for every employee<li> <li>NEST Pension option to choose greener funds<li> <li>£1000 per year for you to spend on what matters to <em>you <em>from learning and development to healthcare to mental wellbeing to gym membership you choose<li> <li>25 days plus a day for your birthday wedding day and moving day as well as up to 1 day per quarter for you to volunteer<li> <li>Sabbatical offered after 3 years service<li> <li>Highspec laptop and equipment<li> <li>Flexible working<li> <li>Hybrid remote and office based working We trust you to get the work done start late finish late we don’t mind You are required to be on site Tuesday and Thursday White City location<li> <li>Great exposure and ability to impact a fastgrowing missiondriven food startup<li> <ul> <p>If you need sponsorship to have the right to work fulltime in the UK please let us knownbsp<p> <h4>What you can expect from our recruitment process<h4> <ul> <li>Stage 1 30minute phone interview with our Engineering Manager<li> <li>Stage 2 15 hour technical interviewnbsp<li> <li>Final stage 45 minute interview with VP of Engineering followed by a 15 minute meet the team finalised by a 30 minute call with HR<li> <ul> <p>nbsp<p> <p><strong>Why Collectiv Food<strong><p> <p>Collectiv Food is a next generation food and drink supply business leading the transition to sustainable transparent and fair supply chain for Europe’s professional kitchens Its innovative delivery model enables it to offer marketbeating prices and a reliable service all underpinned by a commitment to sustainability Founded in 2018 we are based in West London and supported by industry experts and leading venture investors such as VNV Global Octopus Norrsken VC VVNP and Partech<p> <p>nbsp<p> <p><strong>Collectiv Food – Our Commitment to fostering a sense of Belonging<strong><p> <p><strong>People and Food United in their Individuality<strong><p> <p>Collectiv Food is an equal opportunity employer We are a diverse bunch of people who are committed to cultivating a welcoming culture of inclusion and equality We see the potential in everyone and value the importance that different backgrounds experiences and ways of thinking can have in igniting innovation and propelling our business forwardnbsp<p> <p>If you share our values love of food and vision to lead the transition to a sustainable fair and transparent food supply chain then we’d love to hear from you and encourage your application Protecting your privacy and the security of your data is a top priority for us at Collectiv Food Please consult our Privacy Notice to know more about how we collect use and transfer the personal data of our candidates<p> <h3><br><br><br><br><h3><br><br>Please mention the word COMMEND and tag RMTMuOTMuMjM5LjI1MA== when applying to show you read the job post completely RMTMuOTMuMjM5LjI1MA== This is a beta feature to avoid spam applicants Companies can search these words to find applicants that read this and see theyre human

Service Designer

Company: IBM

Location: GB London

Posted Feb 16, 2024

<div class=jddescription datafield=description> <span class=showjobdescr style=fontweight bold> Introduction <span> <span class=showjobdescr> <span> <br> In this role youll work in one of our IBM Consulting Client Innovation Centers Delivery Centers where we deliver deep technical and industry expertise to a wide range of public and private sector clients around the world​ Our delivery centers offer our clients locally based skills and technical expertise to drive innovation and adoption of new technology <p> A career in IBM CIC is rooted by longterm relationships and close collaboration with clients across the globe <p> <p> Youll work with visionaries across multiple industries to improve the hybrid cloud and AI journey for the most innovative and valuable companies in the world Your ability to accelerate impact and make meaningful change for your clients is enabled by our strategic partner ecosystem and our robust technology platforms across the IBM portfolio including Software and Red Hat <p> <p> Curiosity and a constant quest for knowledge serve as the foundation to success in IBM Consulting In your role youll be encouraged to challenge the norm investigate ideas outside of your role and come up with creative solutions resulting in ground breaking impact for a wide network of clients Our culture of evolution and empathy centers on longterm career growth and development opportunities in an environment that embraces your unique skills and experience <br> <span class=showjobdescr style=fontweight bold> <span> <br> <span class=showjobdescr style=fontweight bold> Your Role and Responsibilities <span> <span class=showjobdescr> <span> <br> Service designers work to create endtoend and fronttoback enterprise experiences for prospects customers business partners and employees that span facetoface and digital interactions They use humancentered approaches to shape and define the value exchange between a service provider and the user across touch points time and channels <p> <p> Your Role and Responsibilities <p> <p> We are looking for a Service Designer to join an agile team The role will involve <p> <ul> <li> Designing concept journeys blueprints and roadmaps that communicate how the total user experience can be elevated beyond the immediate product or service <li> <li> Facilitating the collective understanding of the endtoend fronttoback experience by mapping the orchestration of events at the intersection of technology business and design <li> <li> Shaping how behindthescenes processes and support functions interact with each other and how these impact the design process <li> <li> Embedding design practices within organizations to create a sustainable approach to service the needs of the user <li> <li> Working with User Researchers to generate insights through research with users staff and stakeholders to shape a holistic view of the total user experience <li> <li> Analysing consolidating and communicating research findings to stakeholders in order to strategically frame validate and quantify the problem being solved and help inform the wider strategic roadmap of initiatives <li> <ul> <p> <span class=showjobdescr style=fontweight bold> <span> <br> <span class=showjobdescr style=fontweight bold> Required Technical and Professional Expertise <span> <span class=showjobdescr> <span> <p> <ul> <li> <span style=fontsize13px> <span style=fontfamilyArialHelveticasansserif> Experience of planning scoping conducting analysis and communicating Service Design throughout the Agile product development lifecycle <span> <span> <li> <li> <span style=fontsize13px> <span style=fontfamilyArialHelveticasansserif> Experience of planning and facilitating workshops to reach a specific outcome <span> <span> <li> <li> <span style=fontsize13px> <span style=fontfamilyArialHelveticasansserif> Experience of working within an Agile scrum team working across Designers Product Owners Developers Business Analysts and other Researchers <span> <span> <li> <li> <span style=fontsize13px> <span style=fontfamilyArialHelveticasansserif> Ability to convert a single or a group of research findings into specific prioritised recommendations <span> <span> <li> <li> <span style=fontsize13px> <span style=fontfamilyArialHelveticasansserif> Ability to use tooling that supports the creation of service design artefacts <span> <span> <li> <ul> <p> <span style=fontsize13px> <span style=fontfamilyArialHelveticasansserif> As an equal opportunities employer we welcome applications from individuals of all backgrounds However for you to be eligible for this role you must have the valid right to work in the UK Unfortunately we do not offer visa sponsorship and have no future plans to do so <span> <span> <br> <span class=showjobdescr style=fontweight bold> <span> <br> <span class=showjobdescr style=fontweight bold> Preferred Technical and Professional Expertise <span> <span class=showjobdescr> <span> <br> NA <p><div>

Senior Android Engineer

Company: Blockchain

Location: London - Hybrid

Posted Feb 15, 2024

<p><strong>Blockchaincom is the worlds leading software platform for digital assets Offering the largest production blockchain platform in the world we share the passion to code create and ultimately build an open accessible and fair financial future one piece of software at a time<strong><p> <p><span style=fontweight400>Blockchaincom’s engineering team is building technologies that are revolutionising the financial services industry by empowering millions across the globe to authenticate and transact immediately and without costly intermediaries<span><p> <p><span style=fontweight400>We are looking for a Senior Android Engineer to join our growing engineering team to rapidly create iterate and launch highquality software that empowers users all over the world Ultimately you should be able to adapt easily to meet the needs of our fast growth and the rapidly evolving crypto ecosystem<span><p> <p><span style=fontweight400>Our development team is tackling some of the most interesting problems in the crypto space while rapidly and securely scaling a distributed platform that touches millions of people a day We want you to join us<span><p> <p><strong>WHAT YOU WILL DO<strong><p> <ul> <li style=fontweight400> <span style=fontweight400>Be part of a team that is building industryleading bitcoin wallets for users around the globe <span><a href=httpsplaygooglecomstoreappsdetailsid=piukblockchainandroidhl=enGB rel=noopener noreferrer nofollow><span style=fontweight400>View on Google Play<span><a> <li> <li style=fontweight400><span style=fontweight400>Write welltested reliable code for use by millions of users who use our wallet<span><li> <li style=fontweight400><span style=fontweight400>Proactively collaborate with team members ensuring the sharing of knowledge and efficient division of labour<span><li> <li style=fontweight400><span style=fontweight400>Work on the most interesting and challenging problems in the cryptocurrency space<span><li> <li style=fontweight400><span style=fontweight400>Get exposure to the latest technologies and developments in a technology and product driven company<span><li> <li style=fontweight400><span style=fontweight400>Work on an industryleading product with millions of users<span><li> <ul> <p><strong>WHAT YOU WILL NEED<strong><p> <ul> <li style=fontweight400><span style=fontweight400>The foremost quality for this position or any position at Blockchaincom is integrity<span><li> <li style=fontweight400><span style=fontweight400>At least 3 years of experience working with Java Kotlin and the Android SDK and have at least one or two apps in the store<span><li> <li style=fontweight400><span style=fontweight400>Experience with reactive programming RxJava or otherwise is a bonus<span><li> <li style=fontweight400><span style=fontweight400>You are excited about using the latest Android features to build the best app in class<span><li> <li style=fontweight400><span style=fontweight400>You feel ownership over everything you ship—youd never call code released until you’re confident it’s correct<span><li> <li style=fontweight400><span style=fontweight400>Unit testingTDD and achieving a high level of coverage should be second nature to you<span><li> <li style=fontweight400><span style=fontweight400>You should be able to adapt easily to meet the needs of our massive growth and rapidly evolving business environment<span><li> <li style=fontweight400><span style=fontweight400>You rely on others candid feedback for continuous improvement<span><li> <li style=fontweight400> <span style=fontweight400>Excellent communication skills to liaise with various team members around the world<span><span style=fontweight400><span> <li> <li style=fontweight400><span style=fontweight400>Strong analytical and problemsolving skills<span><li> <li style=fontweight400><span style=fontweight400>You enjoy learning new things<span><li> <ul> <div class=prichtextsection><strong>COMPENSATION PERKS<strong><div> <ul class=prichtextlist prichtextlistbullet> <li>Competitive fulltime salary based on experience and meaningful equity in an industryleading company<li> <li>The opportunity to be a key player and build your career at a rapidly expanding global technology company in an exciting emerging industry<li> <li>Unlimited vacation policy work hard and take time when you need it<li> <li>Performancebased bonuses paid in cash<li> <li>Apple equipment provided by the company<li> <li>Awesome office locations and remote working options<li> <ul><br><br>Please mention the word PROSPROS and tag RNTIuMTYwLjExMS41Ng== when applying to show you read the job post completely RNTIuMTYwLjExMS41Ng== This is a beta feature to avoid spam applicants Companies can search these words to find applicants that read this and see theyre human

SAP Security Lead UKI

Company: IBM

Location: GB London

Posted Mar 05, 2024

<div class=jddescription datafield=description> <span class=showjobdescr style=fontweight bold> Introduction <span> <span class=showjobdescr> <span> <br> The protection of SAP systems as missioncritical applications is becoming a priority for the most relevant organizations all over the world IBM Security considers that the security of SAP systems is key to many of our clients in these uncertain times where hackers are seeing SAP as a ready target to perform successful attacks <p> As the UKI SAP Security Lead you will be a key advisor for IBM clients analysing business requirements and problems to identify design and oversee the implementation of the leading SAP Security solutions for their needs <p> <p> You will apply your SAP Security skills to find the balance from the technical security and compliance perspectives helping our clients to secure their critical SAP applications ensuring regulatory compliance and developing industryleading services <br> <span class=showjobdescr style=fontweight bold> <span> <br> <span class=showjobdescr style=fontweight bold> Your Role and Responsibilities <span> <span class=showjobdescr> <span> <br> <span style=fontsize14px> The main activities required from this role are the following <span> <p> <p> <span style=lineheightnormal> <span style=verticalalignbaseline> <span calibri= style=fontfamily> <b> <span arial= style=bordernone windowtext 10pt fontfamily> <span style=color6f6f6f> Your Role and Responsibilities <span> <span> <b> <span> <span> <span> <br> <span style=lineheight107> <span calibri= style=fontfamily> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color6f6f6f> The main activities required from this role are the following <span> <span> <span> <span> <span> <span> <p> <ul> <li style=textalignjustify marginleft8px> <span style=fontsize14px> <span style=lineheight107> <span calibri= style=fontfamily> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color6f6f6f> Identifying SAP security opportunities alongside our sector leads and clientfacing partners <span> <span> <span> <span> <span> <span> <span> <li> <li style=textalignjustify marginleft8px> <span style=fontsize14px> <span style=lineheight107> <span calibri= style=fontfamily> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color6f6f6f> Pursuit of SAP security opportunities <span> <span> <span> <span> <span> <span> <span> <li> <li style=textalignjustify marginleft8px> <span style=fontsize14px> <span style=lineheight107> <span calibri= style=fontfamily> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color6f6f6f> Developing SAP security proposals both proactive and in response to market activity <span> <span> <span> <span> <span> <span> <span> <li> <li style=textalignjustify marginleft8px> <span style=fontsize14px> <span style=lineheight107> <span calibri= style=fontfamily> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color6f6f6f> Preparation of technical SAP Security proposals <span> <span> <span> <span> <span> <span> <span> <li> <li style=textalignjustify marginleft8px> <span style=fontsize14px> <span style=lineheight107> <span calibri= style=fontfamily> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color6f6f6f> Perform technical solutioning for SAP Security requirements <span> <span> <span> <span> <span> <span> <span> <li> <li style=textalignjustify marginleft8px> <span style=fontsize14px> <span style=lineheight107> <span calibri= style=fontfamily> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color6f6f6f> Oversee and ensure the quality of SAP Security services provided by the delivery team <span> <span> <span> <span> <span> <span> <span> <li> <li style=textalignjustify marginleft8px> <span style=fontsize14px> <span style=lineheight107> <span calibri= style=fontfamily> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color6f6f6f> Lead implementations and provide support to the delivery team when needed <span> <span> <span> <span> <span> <span> <span> <li> <li style=textalignjustify marginleft8px> <span style=fontsize14px> <span style=lineheight107> <span calibri= style=fontfamily> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color6f6f6f> Become a focal point trusted advisor for IBM clients in SAP Security domain <span> <span> <span> <span> <span> <span> <span> <li> <li style=textalignjustify marginleft8px> <span style=fontsize14px> <span style=lineheight107> <span calibri= style=fontfamily> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color6f6f6f> Development of offerings methodologiespoint of view about innovative technologiesservices <span> <span> <span> <span> <span> <span> <span> <li> <li style=marginbottom11px marginleft8px> <span style=fontsize14px> <span style=lineheight107> <span calibri= style=fontfamily> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color6f6f6f> Leads the UKIs and play a significant role in longterm IBMs SAP Security strategy and operational excellence <span> <span> <span> <span> <span> <span> <span> <li> <ul> <p> <span style=fontsize14px> <span style=lineheightnormal> <span style=verticalalignbaseline> <span calibri= style=fontfamily> <b> <span arial= style=bordernone windowtext 10pt fontfamily> <span style=color6f6f6f> Professional Expertise Profile <span> <span> <b> <span> <span> <span> <span> <p> <ul> <li style=textalignjustify marginleft8px> <span style=fontsize14px> <span style=lineheight107> <span calibri= style=fontfamily> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color6f6f6f> Extensive SAP Security professional experience in several Life Cycles <span> <span> <span> <span> <span> <span> <span> <li> <li style=textalignjustify marginleft8px> <span style=fontsize14px> <span style=lineheight107> <span calibri= style=fontfamily> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color6f6f6f> Must have led multiple SAP Security projects covering all the implementation phases <span> <span> <span> <span> <span> <span> <span> <li> <li style=textalignjustify marginleft8px> <span style=fontsize14px> <span style=lineheight107> <span calibri= style=fontfamily> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color6f6f6f> Big4leading SI consulting experience including business development <span> <span> <span> <span> <span> <span> <span> <li> <li style=textalignjustify marginleft8px> <span style=fontsize14px> <span style=lineheight107> <span calibri= style=fontfamily> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color6f6f6f> Experience working in both delivery and project management fields <span> <span> <span> <span> <span> <span> <span> <li> <li style=textalignjustify marginleft8px> <span style=fontsize14px> <span style=lineheight107> <span calibri= style=fontfamily> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color6f6f6f> Experience in developing and overseeing the delivery of project deliverables with high standards of quality <span> <span> <span> <span> <span> <span> <span> <li> <li style=textalignjustify marginleft8px> <span style=fontsize14px> <span style=lineheightnormal> <span style=verticalalignbaseline> <span calibri= style=fontfamily> <span style=border 1pt windowtext padding 0cm> <span arial= style=fontfamily> <span style=color6f6f6f> Motivation to develop and lead the UKI SAP security market <span> <span> <span> <span> <span> <span> <span> <li> <li style=textalignjustify marginleft8px> <span style=fontsize14px> <span style=lineheightnormal> <span style=verticalalignbaseline> <span calibri= style=fontfamily> <span style=border 1pt windowtext padding 0cm> <span arial= style=fontfamily> <span style=color6f6f6f> Proactive attitude and selflearning skills <span> <span> <span> <span> <span> <span> <span> <li> <ul> <p> <span style=fontsize14px> <span style=lineheightnormal> <span style=verticalalignbaseline> <span calibri= style=fontfamily> <b> <span arial= style=bordernone windowtext 10pt fontfamily> <span style=color6f6f6f> Background Skills <span> <span> <b> <span> <span> <span> <br> <span style=lineheight107> <span calibri= style=fontfamily> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color6f6f6f> For the SAP Security portfolio it would be desirable <u> to have experience in the following areas and SAP Security solutions <u> <span> <span> <span> <span> <span> <span> <span> <p> <p> <span style=lineheight107> <span calibri= style=fontfamily> <b> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color4472c4> SAP Access Management <span> <span> <span> <span> <b> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color6f6f6f> SAP GRC Access Control Identity amp Access Management Identity and Access Governance inc Cloud Cloud Bridge SoD Models amp Implementations Greenlight AVM <span> <span> <span> <span> <span> <span> <p> <p> <span style=lineheight107> <span calibri= style=fontfamily> <b> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color4472c4> SAP Authentication <span> <span> <span> <span> <b> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color6f6f6f> Single SignOn 30 SAP Authenticator <span> <span> <span> <span> <b> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color4472c4> <span> <span> <span> <span> <b> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color6f6f6f> Integration with Active Directory LDAP SSO solutions SNC and other secure protocols using SAP Cryptographic Library <span> <span> <span> <span> <span> <span> <p> <p> <span style=lineheight107> <span calibri= style=fontfamily> <b> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color4472c4> CCM Continuous Control Monitoring for SAP <span> <span> <span> <span> <b> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color6f6f6f> GRC Process Control <span> <span> <span> <span> <b> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color4472c4> <span> <span> <span> <span> <b> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color6f6f6f> BIS Business Integrity Screening <span> <span> <span> <span> <b> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color4472c4> <span> <span> <span> <span> <b> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color6f6f6f> Creation of custommade automatic controls ABAP HANA SLT SDI SDQ <span> <span> <span> <span> <span> <span> <p> <p> <span style=lineheight107> <span calibri= style=fontfamily> <b> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color4472c4> SAP Security hardening <span> <span> <span> <span> <b> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color6f6f6f> SAP Security Baseline <span> <span> <span> <span> <b> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color4472c4> <span> <span> <span> <span> <b> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color6f6f6f> BASIS and NetWeaver <span> <span> <span> <span> <b> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color4472c4> <span> <span> <span> <span> <b> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color6f6f6f> SAP best practice security configuration vulnerability management for SAP <span> <span> <span> <span> <b> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color4472c4> <span> <span> <span> <span> <b> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color6f6f6f> SAP Solution Manager in the Security domain <span> <span> <span> <span> <b> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color4472c4> <span> <span> <span> <span> <b> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color6f6f6f> SAP FRUN for Security <span> <span> <span> <span> <span> <span> <p> <p> <span style=lineheight107> <span calibri= style=fontfamily> <b> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color4472c4> SAPSIEM integration <span> <span> <span> <span> <b> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color6f6f6f> SAP ETD Enterprise Threat Detection implementation and configuration understanding of market SIEMSOAR solution <span> <span> <span> <span> <span> <span> <p> <p> <span style=lineheight107> <span calibri= style=fontfamily> <b> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color4472c4> DevSecOps in SAP <span> <span> <span> <span> <b> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color6f6f6f> SAP ATC ABAP Test Cockpit <span> <span> <span> <span> <b> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color4472c4> <span> <span> <span> <span> <b> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color6f6f6f> SAP CVA Code Vulnerability Analyzer <span> <span> <span> <span> <b> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color4472c4> <span> <span> <span> <span> <b> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color6f6f6f> SAP Solution Manager CCLM CharM BPMon <span> <span> <span> <span> <span> <span> <p> <p> <span style=lineheight107> <span calibri= style=fontfamily> <b> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color4472c4> SAP Data Privacy <span> <span> <span> <span> <b> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color6f6f6f> ILM Information Lifecyle Management <span> <span> <span> <span> <b> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color4472c4> <span> <span> <span> <span> <b> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color6f6f6f> UI LoggingMasking DRTM for SAP SuccessFactors GDP <span> <span> <span> <span> <b> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color4472c4> <span> <span> <span> <span> <b> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color6f6f6f> SAP HANA encryption <span> <span> <span> <span> <span> <span> <p> <p> <span style=lineheightnormal> <span style=verticalalignbaseline> <span calibri= style=fontfamily> <b> <span arial= style=bordernone windowtext 10pt fontfamily> <span style=color6f6f6f> Education <span> <span> <b> <span> <span> <span> <p> <ul> <li style=textalignjustify marginleft8px> <span style=fontsize14px> <span style=lineheight107> <span calibri= style=fontfamily> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color6f6f6f> Bachelors Degree <span> <span> <span> <span> <span> <span> <span> <li> <li style=textalignjustify marginleft8px> <span style=fontsize14px> <span style=lineheight107> <span calibri= style=fontfamily> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color6f6f6f> CISA and CISM certification <span> <span> <span> <span> <span> <span> <span> <li> <li style=textalignjustify marginleft8px> <span style=fontsize14px> <span style=lineheight107> <span calibri= style=fontfamily> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color6f6f6f> SAP Security certifications <span> <span> <span> <span> <span> <span> <span> <li> <li style=textalignjustify marginleft8px> <span style=fontsize14px> <span style=lineheight107> <span calibri= style=fontfamily> <span style=border 1pt windowtext padding 0cm> <span style=lineheight107> <span arial= style=fontfamily> <span style=color6f6f6f> Fluent English written and oral communication <span> <span> <span> <span> <span> <span> <span> <li> <ul> <p> <span style=fontsize14px> <strong> Additional details to be noted <strong> <span> <p> <p> Please note candidates applying to this position need to live and work in the UK at the time of application This is a Hybrid working role with the expectation for travel 2 days a week to the client site or office <p> <p> <p> <p> <span class=showjobdescr style=fontweight bold> <span> <br> <span class=showjobdescr style=fontweight bold> Required Technical and Professional Expertise <span> <span class=showjobdescr> <span> <br> <br> <span class=showjobdescr style=fontweight bold> <span> <br> <span class=showjobdescr style=fontweight bold> Preferred Technical and Professional Expertise <span> <span class=showjobdescr> <span> <br> <p><div>

Frequently Asked Questions

What are typical salary ranges for Full Time tech roles across different seniority levels?
Typical full-time tech salaries vary significantly by role, location, and company. For a Software Engineer, junior roles might range from $70,000-$100,000, mid-level from $100,000-$150,000, and senior/lead positions from $150,000-$250,000+. Data Scientists often command similar or slightly higher ranges, especially with expertise in AI/ML. These figures usually represent base salary, with full-time roles frequently including additional compensation like performance bonuses, stock options, and comprehensive benefits packages.
What core skills and certifications are most valued for Full Time tech positions?
For full-time tech roles, strong foundational programming skills in languages like Python, Java, JavaScript, or Go are essential. Expertise in cloud platforms (AWS Certified Solutions Architect, Microsoft Certified: Azure Developer Associate), containerization (Docker, Kubernetes), and CI/CD pipelines is highly valued for DevOps roles. Data professionals benefit from certifications in SQL, Spark, and machine learning frameworks. For project management, PMP or Agile certifications (CSM, SAFe) are often sought after, demonstrating a structured approach to project delivery.
How prevalent is remote work for Full Time tech roles, and what are the considerations?
Remote and hybrid full-time tech roles are highly prevalent, especially for software development, data science, and cybersecurity positions. Many companies now offer fully remote options, recognizing the talent pool extends beyond geographical boundaries. Considerations for remote full-time work include maintaining strong communication skills, effective time management, a dedicated home office setup, and proficiency with collaboration tools like Slack, Zoom, and Jira. Employers typically provide necessary equipment and ensure benefits parity with in-office roles.
What are common career progression paths for Full Time professionals in tech?
Full-time tech professionals often follow two primary career paths: the Individual Contributor (IC) track or the Management track. The IC track progresses from Junior to Mid-Level, Senior, Staff, and ultimately Principal Engineer, focusing on deep technical expertise and architectural leadership. The Management track typically moves from Team Lead to Engineering Manager, Director of Engineering, and VP of Engineering, focusing on team leadership, strategy, and organizational growth. Cross-functional moves, like a Developer transitioning to a Solutions Architect or Technical Product Manager, are also common.
What are the current industry trends impacting Full Time tech employment?
Several key trends are shaping full-time tech employment. The rapid adoption of AI and Machine Learning across industries is driving demand for specialized ML Engineers and AI Researchers. Cloud-native development and serverless architectures continue to grow, creating opportunities for Cloud Engineers and DevOps specialists. Cybersecurity remains a critical area, with increasing full-time roles focused on threat detection, incident response, and data privacy compliance. Furthermore, the push for sustainable tech and green computing is emerging as a new focus for full-time innovation and development roles.

Related Pages

© 2026 Job Transparency. All rights reserved.