Tech Jobs in Milan, Italy

6,246 open positions · Updated daily

Milan stands out as a tech hub that blends world‑class fashion, design, and finance with cutting‑edge software development. The city hosts global giants such as Amazon Italy, Accenture, and Samsung Electronics, along with a vibrant startup scene in districts like Corso Como and Porta Nuova. High‑quality universities—Politecnico di Milano, Bocconi—provide a steady stream of engineers, while the city’s excellent public transport and international airports make it easy to stay connected.

Tech talent in Milan is sought across several booming sectors: fintech firms like Satispay and Unicredit, automotive software at companies such as Ducati and Pirelli, fashion‑tech start‑ups using AI to personalize shopping, and green‑tech ventures developing sustainable mobility solutions. IT services firms—Capgemini, Altran, and local consultancies—also keep a steady demand for developers, data scientists, and UX designers.

While Milan offers high salaries, living costs are also significant. A one‑bedroom apartment in the city center averages €1,200–€1,500 per month, and groceries, utilities, and transport add another €400–€600. Salary transparency lets candidates compare offers against real living expenses, ensuring they can afford the lifestyle they desire in neighborhoods like Brera, Navigli, or the newly‑developed Porta Nuova district.

Recreation Assistant (Physical Fitness) NF-02

Company: Department of the Army

Location: Vicenza, Italy Vicenza, Italy

Posted Mar 06, 2024

This text provides instructions on how to apply for a job position. It outlines two methods of submission: electronically through the USAJobs website using the Vacancy Number 12296139, and manually by following instructions in the 'Additional Information' section. The announcement closes at 11:59 PM Eastern Time on the specified closing date. Contact information for the Vicenza NAF HRO is provided, including a phone number, email, and address. The text concludes by stating that resumes will be reviewed to verify qualifications.

Customer Care Specialist

Company: Unger Academy

Location: Italy

Posted Dec 28, 2023

Unger Academy, an Italian multinational company founded by a 4-time World Trading Champion, is seeking an experienced Customer Care Specialist. The role involves sales support, follow-ups with prospects, post-sales support, resolving customer care requests, monitoring NPS responses, and strategizing for service excellence. The ideal candidate should be a self-starter, have excellent people skills, a passion for continuous learning, and previous customer care experience. The company offers remote work with flexible hours.

Recreation Aid NF-01

Company: Department of the Army

Location: Vicenza, Italy Vicenza, Italy

Posted Mar 06, 2024

Help Help How to Apply You may submit your application package using one of the two methods identified below Electronically preferred at httpswwwusajobsgov and search for Vacancy Number VIN 12300104 Announcement closes at 1159 PM Eastern Time on the closing date listed on this announcement Manually Please refer to the Additional Information section of this announcement for instructions Agency contact information Vicenza NAF HRO Vicenza NAF HRO Phone 00390509658166 Email usarmyusagitalyhqdacpaclistnafarmymil Address JNNAFW6E7AA USAG VICENZA DO NOT MAIL APO AE 09630 US Learn more about this agency Next steps Your resume will be reviewed to verify that qualification requirements have been met We appreciate your interest in this position

Bowling Equipment Worker NA-05

Company: Department of the Army

Location: Vicenza, Italy Vicenza, Italy

Posted Mar 06, 2024

Help Help How to Apply You may submit your application package using one of the two methods identified below Electronically preferred at httpswwwusajobsgov and search for Vacancy Number VIN 12294462 Announcement closes at 1159 PM Eastern Time on the closing date listed on this announcement Manually Please refer to the Additional Information section of this announcement for instructions Agency contact information Vicenza NAF HRO Vicenza NAF HRO Phone 00390509658166 Email usarmyusagitalyhqdacpaclistnafarmymil Address JNNAFW6E7AA USAG VICENZA DO NOT MAIL APO AE 09630 US Learn more about this agency Next steps Your resume will be reviewed to verify that qualification requirements have been met We appreciate your interest in this position

Account Executive DACH

Company: Matterport

Location: UK, Germany, France, Italy

Posted Mar 06, 2024

<div>Matterport Inc Nasdaq MTTR is leading the digital transformation of the built world Our groundbreaking spatial data platform turns buildings into property intelligence data to make nearly every space more valuable and accessible Millions of buildings in more than 177 countries have been transformed into immersive Matterport digital twins to improve every part of the building lifecycle from planning construction and operations to documentation appraisal and marketing Learn more at <a class=postingslink href=httpmatterportcom rel=nofollow>matterportcom<a> and browse a gallery of digital twins <div><div><br><div><div>Visit our <a class=postingslink href=httpswwwcomparablycomcompaniesmatterport rel=nofollow>Matterport Comparably Profile<a> to learn more about working at Matterport and the awards we have won for being a Great Place to Work<div><div><br><div><div><br><div><div>The Role<div><div><br><div><div>Matterport is looking for a Direct Sales Account Executive who is enthusiastic and performance driven to join a team that sells Matterport solutions and services to a range of medium to large customers across our EMEA Core Markets UK France Germany Italy <div><div><br><div><div>This role is to serve our DACH market and the ideal candidate is fluent in German The candidate is highly motivated a self starter amp driven and has experience in selling solutions and services in a consultative manner They thrive in a fast paced environment and are driven to be the expert in the industries they serve<div><div><br><div><div>LIRemote<div><div><br><div><br><br><div class=h3>What you will do<div><li style=>Deliver on quarterly targets for SaaS amp Services<li><li style=>Focus on driving New Sales across regions across DACH <li><li style=>Build a healthy pipeline of business by prospecting yourself and working with your BDR across your territory<li><li style=>Be operationally excellent in the daytoday running of your territory by Accurately forecasting weekly monthly and quarterly numbers<li><li style=>Excellent Sales Hygiene and discipline using tools such as SFDC Clari Groove Highspot Linkedn <li><li style=>Be a team player working across the team of Services Customer Success Support and PreSales team to ensure we have the right plans to support our customers<li><li style=>Attend Sales meetings and prepare presentations <li><li style=>Attend relevant trade shows when required<li><li style=>Deliver sales technical presentations amp demos to potential customers via both web presentations and on site presentations as required<li><li style=>Report to Head of EMEA Direct Sales <li><br><br><div class=h3>Who you are<div><li style=>68 years of SaaS sales experience with at least 2 years of closing complex multi year deals<li><li style=>Ability to create and build pipeline which closes within 49 months<li><li style=>Proven track record in sales across DACH EMEA<li><li style=>Experienced in solution selling ideally utilizing known sales methodologies<li><li style=>History of achieving 100 sales quotas SAAS ACV<li><li style=>Experience working in the SaaS Technology Space serving clients in one or many of these industries Commercial or Residential Real Estate Facilities Management Manufacturing Travel amp Hospitality Construction<li><li style=>Must be energetic team player presentable and professional<li><li style=>Excellent written verbal and presentation skills<li><li style=>Fluent in German both written and verbal additional European languages would be an advantage but not essential<li><div><br><div><div>We want to hear from you We are looking to build the best team of people who will be empowered to do their best work If you have what it takes but dont necessarily meet every bullet in the job description we encourage you to apply<div><div><br><div><div>At Matterport we dont just accept differences we celebrate them and recognize the value they bring to our customers and employees Matterport is proud to be an equal opportunity workplace and works to create and support diversity at Matterport Equal opportunity and consideration are afforded to all qualified applicants and employees We wont unlawfully discriminate on the basis of gender identity or expression race ethnicity religion national origin age sex marital status physical or mental disability veteran status sexual orientation and any other category protected by law We are committed to providing employees with a work environment that provides a sense of inclusion and belonging and is free of discrimination and harassment We also consider all qualified candidates regardless of criminal histories consistent with legal requirements<div><div><br><div><div>Matterport is likewise committed to working with and providing reasonable accommodation to all qualified applicants and employees with disabilities in accordance with the American Disabilities Act<div><div><br><div><div><br><div><div>For more information regarding how Matterport collects and uses personal information please review our Privacy Policies <a class=postingslink href=httpsmatterportcomprivacypolicy rel=nofollow>httpsmatterportcomprivacypolicy<a><div><img src=httpsremotivecomjobtrack1899940blankgifsource=publicapi alt=>

Sales Development Representative

Company: Element

Location: UK, Germany, Italy, Ireland, Switzerland

Posted Nov 18, 2023

Element, a start-up behind the secure, open, decentralised communication project Matrix, is seeking an experienced SDR to manage inbound and outbound sales development. The role involves triaging inbound queries, conducting discovery calls, and prospecting key accounts. The ideal candidate should have 4+ years of experience, strong technical knowledge, and excellent phone skills. They should be passionate about open source technology and committed to Element's values. The role offers a competitive benefits package and the opportunity to work remotely from Germany, Ireland, Italy, Switzerland, or the UK.

Principal Research Analyst (m/f/x)

Company: Quointelligence

Location: Italy

Posted Dec 07, 2023

We review all applications. QuoIntelligence is an equal opportunity employer. Multicultural and multilingual organization. Yearly global meetups in great locations. The shortlisted candidate might as well meet the Research team. Since December 2022, we operate a transparent compensation framework. Fluent in English, additional fluency in Italian, Spanish, German, and/or French will be considered as an asset. Creative environment where team members are encouraged to contribute to processes, decisions, planning and culture. Be comfortable: 1,000 EUR gross home office budget. Be learning: 2,000 EUR / year personal development budget.

Laravel Developer

Company: Plentific

Location: UK, Germany, Portugal, Poland, Italy, Turkey, Spain

Posted Nov 06, 2023

Plentific, a global real-time property solutions company, is seeking top talent for a fully remote position based in the UK, Germany, Turkey, Poland, Italy, Spain, or Portugal. The role involves developing and maintaining Laravel based projects. Requirements include at least 2 years of experience in modern PHP frameworks, good knowledge of frontend frameworks, HTML, JavaScript, CSS, and Git. The company offers a competitive compensation package, flexible working environment, private health care, enhanced parental leave, life insurance, employee assistance program, company volunteering day, charity salary sacrifice scheme, learning management system, learning and development fund, referral bonus, season ticket loan, cycle to work, electric vehicle and Techscheme programs, pension, weekly lunch, and regular social gatherings.

Expansion Manager Italy (m/f/d) - B2B and SaaS

Company: Fiskaly

Location: Italy

Posted Feb 12, 2024

The job posting describes a remote role for a go-to-market strategy planner and executor for Italy. The successful candidate will be the figurehead for the company's expansion into Italy, with the potential to become country manager. Responsibilities include reaching out to businesses, attending industry events, promoting a solutions-based sales approach, and participating in sales and marketing activities. The ideal candidate should have at least 3 years of sales/business development experience, preferably in SaaS, retail, PoS, fintech, payment, or hospitality industries. Fluency in Italian and English is required. The company offers a gross salary between EUR 50k - 60k/year, flexible working hours, domain knowledge trainings, and autonomy. The company values diversity and encourages applications from all backgrounds.

CYP Leader

Company: Department of the Navy

Location: Naples, Italy Naples, Italy

Posted Mar 06, 2024

Help Help How to Apply To be considered for this vacancy you must apply and complete the online questionnaire and submit the documentation specified in the Required Documents section above The complete application package must be submitted by 1159 PM EST on 09302024 to receive consideration To begin click Apply to access the online application You will need to be logged into your USAJOBS account to apply If you do not have a USAJOBS account you will need to create one before beginning the application To preview the Application Questionnaire please click the following link httpsapplyusastaffinggovViewQuestionnaire12268643 Additional information on how to complete the online application process and submit your online application may be found on the httpshelpusastaffinggovApplyindexphptitle=Applicant To verify or check the status of your application log into your USAJobs account Once logged in the Welcome screen lists your applications your application status and the date it was last updated For information on what each Application Status means visit httpswwwusajobsgovHelphowtoapplicationstatus DON is an Equal Employment Opportunity Employer All qualified candidates will receive consideration without regard to race color national origin religion sex age mental or physical disability genetic information reprisal marital status political affiliation sexual orientation or any other nonmerit factor The DON provides reasonable accommodations to applicants with disabilities Applicants with disabilities who believe they may require reasonable accommodations should email their request to MILLHQNAFHRFCTnavymil to ensure proper consideration is given Agency contact information CNRE NAF HRO CNRE NAF HRO Phone 0815682838 Email NAFPersonneleunavymil Address Region NAF HRO NSA Naples PSC 817 Box 108 FPO AE 096220108 US Learn more about this agency Next steps Using the required qualifications of the position a standardized rating and ranking criteria of knowledge skills and abilities will be used to screen and assess each application If you provided an email address you will receive an email message acknowledging receipt of your application Times may vary during the hiring process as your application status updateschanges you will be notified with a notification letter via email Please notify us if your contact information changes after the closing date of the announcement Also note that if you provide an email address that is inaccurate or if your mailbox is full or blocked eg Spam Blocker etc you may not receive important communication that could affect your consideration for this position

Senior DevOps Engineer

Company: Nearform

Location: Italy

Posted Oct 20, 2023

NearForm is seeking a Senior DevOps Engineer for a remote, permanent position based in Italy. The ideal candidate should have extensive experience in DevOps, container orchestration (especially Kubernetes), infrastructure as code, and cloud platforms like GCP. They will work on diverse projects, developing infrastructure, creating deployment pipelines, and implementing monitoring architecture. NearForm offers a flexible work environment, wellness support, and a tight-knit team culture. The recruitment process includes a TalentCall, an assessment, and a video call with a Hiring Manager.

Senior Software Engineer (Frontend)

Company: JOOR

Location: UK, Italy, Spain

Posted Feb 23, 2024

<p><strong>Who We Are<strong><p> <p>Founded in 2010 JOOR now services more than 14000 brands and over 600000 buyers across 150 countries processing an incredible $17B in wholesale transaction volume each month Backed by Macquarie Group Battery Ventures Canaan Partners amp ITOCHU JOOR is a Series D startup that provides the worlds most recognized brands and retailers with a digital wholesale management platform that transforms the way these businesses work<p> <p>With a CEO recently named a Glossy 50 Changemaker in the Fashion Industry and inducted into Forbes 50 Over 50 2022 class JOOR is attracting top talent to drive market dominance With our team of 150+ experts we maintain an established global presence with employees in key markets in North America Europe and APAC<p> <p><strong>Why JOOR <strong><p> <ul style=> <li style=><a href=22httpswwwbusinessoffashioncomarticlesnewsanalysishowtechnologyistransformingglobalwholesalemarkets22 rel=nofollow><strong>We are revolutionizing the virtual showroom experience <strong><a><li> <ul> <ul style=> <li style=><a href=22httpswwwglobenewswirecomnewsrelease2022040524163960enJOORImplementsAutomatedAttributionCapabilitiesThroughanExclusivePartnershipwithLilyAIhtml22 rel=nofollow><strong>We partner with exciting brands and retailers from around the world<strong><a><li> <ul> <ul style=> <li style=><a href=22httpswwwalleywatchcom202106joorwholesalemanagementplatformmarketplacebrandsretailersdigitaltradeshowskristinsavilia22 rel=nofollow><strong>We are a global company that is rapidly growing <strong><a><li> <ul> <ul style=> <li style=><a href=22httpsfootwearnewscom2021businessretailwomentechleaderscreatingcorporatechange120314377822 rel=nofollow><strong>We are one of the most diverse and inclusive tech companies<strong><a><li> <ul> <ul style=> <li style=><a href=22httpswwwglobenewswirecomnewsrelease2022021423846320enJOORMakesWavesintheRetailFashionIndustryThisSpringhtml22 rel=nofollow><strong>We have been recognized as a breakout technology startup continuing to drive innovation in the fashion amp retail industry<strong><a><li> <ul> <p><strong>JOOR Engineering<strong><p> <p>Were growing our engineering team and seeking members who want to set the tone for what technology in the wholesale industry looks like Youll tackle complex problems and build the systems that support emerging independent businesses all the way up to global brands and retailers Our clients rely on our products to grow their business and we are committed to building a fast and scalable product that they love all while using best practices and the latest technologies We have a positive and collaborative culture and our engineers are given a greenfield of opportunity to advance their skills and see their solutions make an immediate impact for some of the worlds best known brands and retailers<p> <p><strong>About our stack<strong><p> <ul style=> <li style=>Running on Kubernetes clusters in AWS and monitored via Datadog<li> <li style=>Storing data in RDS Postgres with some Redis<li> <li style=>Our backend services rely mostly on Django gRPC ApolloGraphQL and some old PHP we want to purify with fire😅<li> <li style=>Lastly our frontend is made with React consuming GraphQL queries<li> <ul> <p><strong>What Youll Be Doing<strong><p> <ul style=> <li style=>Build out JOOR Products on one of our delivery teams which serve thousands of users each day and over 1B of GMV a month<li> <li style=>Design and implement solutions on our frontend systems with a focus on consistency simplicity quality and ability to withstand varying load<li> <li style=>Offer tradeoffs and solutions in partnership with your team amp Product to ensure we are delivering best in class software to our customers at appropriate timelines<li> <li style=>Work with other Software Engineers through pairing and other methods to bring out the best in the team as a mentor and subject matter expert<li> <li style=>Engage in broader organizational technical discussions<li> <li style=>Work with the latest technologies including React Python gRPC graphQL and Node<li> <ul> <p><strong>What Were Looking For<strong><p> <ul style=> <li style=>5+ years experience as a software engineer<li> <li style=>Based on the EU preferably Spain Italy or UK<li> <li style=>Strong communication skills in English Spanish is a big plus<li> <li style=>Extensive knowledge of vanilla JS CSS React is a big plus<li> <li style=>Experience on TypeScript and GraphQL is a very nice have<li> <li style=>Unit testing using proper doubles and strategies<li> <li style=>Teamwork player used to pair programming and peer reviews<li> <li style=>Experience in our stack is a plus but strong foundations are way more relevant<li> <ul> <p><strong>What We Offer<strong><p> <ul style=> <li style=><strong>Target Compensation Range<strong><strong> <strong>EUR 45K 55K plus company performance bonus amp equity <li> <li style=>100 remote position<li> <li style=>Summer Fridays July and August and 36 hoursweek in August<li> <li style=>Private health insurance<li> <li style=>Access to your preferred learning platform Udemy or Codely<li> <li style=>Collaborate with our teams in global offices around the world<li> <li style=>Regular social events including happy hours lunch amp learns company offsites meetups and speaker series<li> <li style=>Transparency into the state of our business via quarterly allhands meetings showcasing the companys performance in relation to revenue and growth<li> <ul> <p>We are one of the few tech companies with a female CEO and 13 of our engineering team is made up of women well above the industry norm Walking our floors youll find people of every shape color ethnicity and creed If you are looking to join a team of innovators and trail blazers who value diversity of thought and experience then JOOR may just be the place for you<p> <p>We are an equal opportunity employer and value diversity at our company We do not discriminate on the basis of race religion color national origin gender sexual orientation age marital status veteran status or disability status<p> <p>Excited about the role but still not 100 you fit the criteria We would still love to hear from you<p><img src=httpsremotivecomjobtrack1897804blankgifsource=publicapi alt=>

Frequently Asked Questions

What types of tech jobs are available in Milan, Italy?
Milan hosts roles ranging from Software Engineer, Backend/Frontend Developer, Data Scientist, Machine Learning Engineer, DevOps Engineer, Cloud Architect, UI/UX Designer, Product Manager, Cybersecurity Analyst, Systems Administrator, and AI Researcher. Many positions focus on fintech, automotive software, fashion‑tech, and green‑tech.
Is remote work common for tech positions in Milan?
Hybrid models dominate, with most large firms requiring 2–3 days on site for collaboration. Start‑ups often offer fully remote or flexible schedules, but expect an in‑office presence for networking and access to local labs.
Who are the major employers hiring tech talent in Milan?
Top employers include Accenture, Capgemini, Amazon Italy, Google Italy, Samsung Electronics, Ducati, Pirelli, Unicredit, Enel, and local fintech like Satispay. The city also hosts numerous incubators—Digital Innovation Hub, 360° Innovation Hub—providing opportunities with early‑stage companies.
What salary can I expect for tech roles in Milan?
Salary ranges vary by role and experience. Junior Software Engineers start at €45k–€55k, mid‑level at €55k–€70k, senior at €70k–€90k. Data Scientists and AI Engineers can earn €60k–€85k. Adjust for cost of living and consider benefits like health insurance, pension, and stock options.
How do I relocate to Milan for a tech job?
Begin by researching neighborhoods: Brera and Navigli offer cultural vibrancy, while Porta Nuova offers modern office spaces. Secure a work permit or EU visa, budget €1,200–€1,500/month for rent, and use local networking events, coworking spaces (Talent Garden, WeWork), and meetup groups to connect with the tech community.

Related Pages