Unwavering Mission Jobs in USA

173,172 open positions · Updated daily

Looking for Unwavering Mission jobs in USA? Browse our curated listings with transparent salary information to find the perfect Unwavering Mission position in the USA area.

Senior Backend Engineer - Shared Services

Company: Webflow

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <p> At Webflow our mission is to bring development superpowers to everyone Webflow is the leading visual development platform for building powerful websites without writing code By combining modern web development technologies into one platform Webflow enables people to build websites visually saving engineering time while clean code seamlessly generates in the background From independent designers and creative agencies to Fortune 500 companies millions worldwide use Webflow to be more nimble creative and collaborative Its the web made better <p> <p> We are looking for a Senior Backend Engineer to join the Shared Services team to enable our engineering team to build more efficiently so we can further our mission of bringing visual development superpowers to everyone If youre passionate about engineering excellence and driving operational efficiency wed love to hear from you <p> <h2> <strong> About the role <strong> <h2> <ul> <li> <p> Location Remotefirst United States BC amp ON Canada <p> <li> <li> <p> Fulltime <p> <li> <li> <p> Permanent <p> <li> <li> <p> Exempt <p> <li> <li> <p> The cash compensation for this role is tailored to align with the cost of labor in different geographic markets Weve structured the base pay ranges for this role into zones for our geographic markets and the specific base pay within the range will be determined by the candidates geographic location jobrelated experience knowledge qualifications and skills <p> <ul> <li> <p> United States all figures cited below in USD and pertain to workers in the United States <p> <ul> <li> <p> Zone A $162500 $216050 <p> <li> <li> <p> Zone B $152700 $203100 <p> <li> <li> <p> Zone C $14300 $190150 <p> <li> <ul> <li> <li> <p> Canada All figures cited below in CAD and pertain to workers in ON amp BC Canada <p> <ul> <li> <p> CAD 184600 CAD 245500 <p> <li> <ul> <li> <ul> <li> <li> <p> Please visit our <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowaboutwebflowiocareers rel=noopener noreferrer nofollow target=blank> Careers page <a> for more information on which locations are included in each of our geographic pay zones However please confirm the zone for your specific location with your recruiter <p> <li> <li> <p> Reporting to the engineering manager <p> <li> <ul> <p> As Senior Backend Engineer youll <p> <ul> <li> <p> Develop a comprehensive knowledge of how areas of business such as architecture and infrastructure integrate to improve developer productivity and accomplish our business goals <p> <li> <li> <p> Collaborate with software engineers product managers designers and QA analysts in an autonomous supportive team environment <p> <li> <li> <p> Build and maintain shared services including but not limited to Inapp Email Notification platform and Feature Flag framework <p> <li> <li> <p> Identify develop and document APIs for Webflows service catalog as well as provide quick start guides for developer best practices <p> <li> <li> <p> Solve problems in a highly technical platform that empowers hundreds of engineers <p> <li> <li> <p> Improve our planning development and deployment processes to help you and your fellow team members <p> <li> <li> <p> Mentor coach and inspire a team of engineers of various levels <p> <li> <ul> <p> In addition to the responsibilities outlined above at Webflow we will support you in identifying where your interests and development opportunities lie and well help you incorporate them into your role <p> <h2> <strong> About you <strong> <h2> <p> Youll thrive in this role if you <p> <ul> <li> <p> Have 5+ years developing and deploying web applications with a proven track record of shipping to market <p> <li> <li> <p> Excellent organization and communication skills both verbal and written <p> <li> <li> <p> Have worked on complex issues where the analysis requires an indepth knowledge of the company and existing architecture <p> <li> <li> <p> Can debug production issues across services and multiple levels of the stack <p> <li> <li> <p> Take pride in taking ownership and driving projects to business impact <p> <li> <li> <p> Proven experience building complex web systems <p> <li> <li> <p> Are familiar with one or more Javascript type systems we use TypeScript here <p> <li> <li> <p> Are comfortable working in an agile safetofail environment <p> <li> <ul> <p> <strong> Our Core Behaviors <strong> <p> <ul> <li> <p> <strong> Obsess over customer experience <strong> We deeply understand <em> what <em> were building and <em> who <em> were building for and serving We define the leading edge of whats possible in our industry and deliver the future for our customers <p> <li> <li> <p> <strong> Move with heartfelt urgency <strong> We have a healthy relationship with impatience channeling it thoughtfully to show up better and faster for our customers and for each other Time is the most limited thing we have and we make the most of every moment <p> <li> <li> <p> <strong> Say the hard thing with care <strong> Our best work often comes from intelligent debate critique and even difficult conversations We speak our minds and dont sugarcoat things and we do so with respect maturity and care <p> <li> <li> <p> <strong> Make your mark <strong> We seek out new and unique ways to create meaningful impact and we champion the same from our colleagues We work as a <em> team <em> to get the job done and we go out of our way to celebrate and reward those going above and beyond for our customers and our teammates <p> <li> <ul> <h3> <strong> Benefits amp wellness <strong> <h3> <ul> <li> <p> Equity ownership RSUs in a growing privatelyowned company <p> <li> <li> <p> 100 employerpaid healthcare vision and dental insurance coverage for employees and dependents fulltime employees working 30+ hours per week as well as Health Savings AccountHealth Reimbursement Account dependent care Flexible Spending Account US only dependent on insurance plan selection where applicable in the respective country of employment Employees may also have voluntary insurance options such as life disability hospital protection accident and critical illness where applicable in the respective country of employment <p> <li> <li> <p> 12 weeks of paid parental leave for both birthing and nonbirthing caregivers as well as an additional 68 weeks of pregnancy disability for birthing parents to be used before child bonding leave where local requirements are more generous employees receive the greater benefit Employees also have access to family planning care and reimbursement <p> <li> <li> <p> Flexible PTO with a mandatory annual minimum of 10 days paid time off for all locations where local requirements are more generous employees receive the greater benefit and sabbatical program <p> <li> <li> <p> Access to mental wellness and professional coaching therapy and Employee Assistance Program <p> <li> <li> <p> Monthly stipends to support health and wellness smart work and professional growth <p> <li> <li> <p> Professional career coaching internal learning amp development programs <p> <li> <li> <p> 401k plan and pension schemes in countries where statutorily required financial wellness benefits like CPA or financial advisor coverage <p> <li> <li> <p> Discounted Pet Insurance offering US only <p> <li> <li> <p> Commuter benefits for inoffice employees <p> <li> <ul> <h3> <strong> Be you with us <strong> <h3> <p> At Webflow equality is a core tenet of our culture We are an Equal Opportunity EEOVeteransDisabled Employer and are <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomdiversityequityinclusion rel=noopener noreferrer nofollow target=blank> committed <a> to building an inclusive global team that represents a variety of backgrounds perspectives beliefs and experiences Employment decisions are made on the basis of jobrelated criteria without regard to race color religion sex sexual orientation gender identity national origin disability veteran status or any other classification protected by applicable law Pursuant to the San Francisco Fair Chance Ordinance Webflow will consider for employment qualified applicants with arrest and conviction records <p> <h3> <strong> Stay connected <strong> <h3> <p> Not ready to apply but want to be part of the Webflow community Consider following our story on our <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomblog rel=noopener noreferrer nofollow target=blank> Webflow Blog <a> <a class=fontbold underline fontbold underline fontbold underline href=httpswwwlinkedincomcompanywebflowinc rel=noopener noreferrer nofollow target=blank> LinkedIn <a> <a class=fontbold underline fontbold underline fontbold underline href=httpstwittercomwebflow rel=noopener noreferrer nofollow target=blank> X Twitter <a> andor <a class=fontbold underline fontbold underline fontbold underline href=httpswwwglassdoorcomReviewsWebflowReviewsE890506htm rel=noopener noreferrer nofollow target=blank> Glassdoor <a> <p> <h3> <strong> Please note <strong> <h3> <p> <em> To join Webflow youll need valid US or Canadian work authorization depending on the country of employment <em> <p> <p> <em> If you are extended an offer that offer may be contingent upon your successful completion of a background check which will be conducted in accordance with applicable laws We may obtain one or more background screening reports about you solely for employment purposes <em> <p> <p> <em> For information about how Webflow processes your personal information please review <em> <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomlegalapplicantprivacynotice rel=noopener noreferrer nofollow target=blank> <em> Webflows Applicant Privacy Notice <em> <a> <em> <em> <p> <p> <p><p>

Senior Director of Integrated Media

Company: Code.org

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <h2> <strong> JOB SUMMARY <strong> <h2> <p> The Senior Director of Media will lead the strategic direction and execution of all paid earned and owned media initiatives to elevate Codeorgs brand and mission This role is responsible for crafting highimpact media strategies that effectively reach target audiences managing media budgets to ensure maximum ROI and forging strategic partnerships to enhance our media presence <p> <h2> <strong> DUTIES AND RESPONSIBILITIES <strong> <h2> <p> Integrated Media Strategy <p> <ul> <li> <p> Develop and execute a unified media strategy that seamlessly integrates paid earned and owned channels ensuring consistent messaging and optimal audience engagement across all platforms to amplify Codeorgs mission and organizational goals <p> <li> <li> <p> Establish and nurture strategic connections and partnerships with media platforms agencies and other relevant organizations to unlock new media opportunities and collaborations <p> <li> <li> <p> Stay at the forefront of media trends and technological advancements adapting and innovating media strategies to maintain competitiveness and relevance in the digital landscape <p> <li> <li> <p> Collaborate closely with marketing and creative teams to ensure seamless integration of media plans with broader marketing campaigns and content strategies <p> <li> <ul> <p> Paid Media Leadership <p> <ul> <li> <p> Focus on strategically investing in paid media channels to target specific audiences enhance visibility and drive measurable outcomes Utilize datadriven insights to allocate budgets effectively continuously optimizing campaigns for maximum ROI <p> <li> <li> <p> Strategically leverage existing partnerships to maximize opportunities for grants and PSAs ensuring optimal placement and exposure to support Codeorgs mission and amplify its impact on a larger scale <p> <li> <ul> <p> Earned Media Leadership <p> <ul> <li> <p> Maximize earned media opportunities through compelling storytelling media relations and influencer partnerships Aim to amplify Codeorgs visibility and credibility by securing coverage and endorsements that resonate with our mission and values <p> <li> <li> <p> Work collaboratively with partners to cocreate and launch impactful campaigns that align with mutual objectives driving increased engagement and support for educational initiatives <p> <li> <ul> <p> Owned Media Leadership <p> <ul> <li> <p> Implement a dynamic social media strategy across Codeorgs platforms to engage audiences share insights and foster community Oversee the social media community management team ensuring active social discussions and participation while maintaining a welcoming environment <p> <li> <li> <p> Enhance Codeorg executives online presence through strategic use of speaking engagements and social media positioning them as key voices in computer science education Oversee the event execution team ensuring all events align with our mission and enhance our objectives <p> <li> <ul> <p> Media Reporting and Analysis <p> <ul> <li> <p> Define clear measurable key performance indicators KPIs tailored to each campaigns objectives ensuring alignment with overall business goals <p> <li> <li> <p> Develop comprehensive media reporting frameworks to track campaign performance across all channels utilizing data analytics to provide actionable insights and detailed postcampaign analysis for continuous improvement <p> <li> <li> <p> Implement ongoing optimization strategies based on realtime data adjusting media placements channel focus and budget allocation to enhance campaign performance and maximize return on investment ROI <p> <li> <li> <p> Establish learning agendas for all major campaigns to test hypotheses and new strategies fostering a culture of innovation and ensuring the media strategy evolves with changing market dynamics <p> <li> <ul> <p> Media Operations Efficiency <p> <ul> <li> <p> Streamline media operations to enhance campaign execution and delivery ensuring seamless integration of planning buying and realtime adjustments across all media channels <p> <li> <li> <p> Oversee the precise trafficking of advertising materials coordinating with creative and media teams to ensure ads are correctly formatted targeted and delivered on schedule <p> <li> <ul> <h2> <strong> EXPERIENCE amp QUALIFICATIONS <strong> <h2> <p> We seek candidates who have <p> <ul> <li> <p> Bachelors degree in Marketing Advertising Communications or a related field <p> <li> <li> <p> Minimum of 10 years of experience in media planning and buying with a significant focus on paid media strategies and execution <p> <li> <li> <p> Proven track record of developing and managing largescale media campaigns that have delivered measurable results <p> <li> <li> <p> Strong analytical skills with expertise in ROI analysis and media metrics <p> <li> <li> <p> Exceptional negotiation and relationshipbuilding skills <p> <li> <ul> <p> We prefer candidates who also have <p> <ul> <li> <p> Experience in the nonprofit or education sector <p> <li> <li> <p> Familiarity with global media strategies and multimarket campaigns <p> <li> <li> <p> Leadership experience with the ability to inspire and guide a team towards achieving shared goals <p> <li> <ul> <p> In addition candidates must <p> <ul> <li> <p> Be a US Citizen or Permanent Resident <p> <li> <li> <p> Pass a preemployment background check <p> <li> <li> <p> Be willing to travel a minimum of two times per year for team events <p> <li> <ul> <p> <p> <h2> <strong> WHAT IS THE INTERVIEW PROCESS LIKE <strong> <h2> <p> Step 1 Informational Interview learn more about the role and share your experience 30 minutes <p> <p> Step 2 Homework ~3 hours <p> <p> Step 3 Interviews with several members of the Codeorg team ~ 3 hours <p> <p> Step 4 Final Interview 1hour <p> <p> Step 5 Reference Checks <p> <p> <u> <em> All interviews are currently being conducted virtually via Zoom <em> <u> <p> <p> <p> <h2> <strong> TO APPLY <strong> <h2> <p> The priority application date for this role is <strong> March 8 2024 <strong> and preference will be given to applications submitted by this date Our team will review all applications and if we believe your qualifications would make a great fit well contact you to schedule an informational interview <p> <h2> <strong> COMPENSATION amp BENEFITS PACKAGE <strong> <h2> <p> The expected salary range for this position is $150000$170000 The actual offer will be at the companys sole discretion and determined by relevant business considerations including the final candidates qualifications years of experience and skillset <p><p>

Research Associate - siRNA/Peptides + Antibody

Company: Vial

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <p> <strong> Who We Are <strong> <p> <p> <p> <p> Vial is a global techdriven CRO providing nextgeneration clinical trial management services The Vial CRO powers its drug discovery arm Battery Bio an AIpowered hyper scalable biotech Battery Bio harnesses Vials unique 90 lower cost structure to produce more affordable drug development with efficient streamlined clinical trials <p> <p> <p> <p> Our mission is to reimagine the drug discovery process to empower scientists to cure all human disease We have assembled a talented team of clinical operators chemists and innovative thinkers to achieve this vision <p> <p> <p> <p> Vial is a San Francisco Californiabased company founded by Simon Burns in October 2020 Since our founding we have become a fastgrowing company of 100+ employees with over $100 million in funding from esteemed investors including General Catalyst Box Group and Byers Capital <p> <p> <p> <p> Vial is rebuilding the infrastructure to advance research By deploying technology at every step we are creating a more efficient future for drug discovery <p> <p> <p> <p> <strong> What Youll Do <strong> <p> <p> Work in a structurebased computationally driven drug discovery paradigm <p> <p> Iteratively scale rethink and collaborate on a drug discovery engine that will scale to hundreds of programs <p> <p> Work on assay development and process development for Vials in house discovery efforts <p> <p> Research new modalities + new approaches and serve as a thought partner to the team <p> <p> Work with other scientists clinicians computational biologists project managers and external partners to accomplish our mission of curing diseases <p> <p> <p> <p> <strong> What Youll Bring <strong> <p> <p> 35 years of experience in Antibody discoveryprogram development or roles directly related to the Research amp Development of antibody programs <p> <p> Entrepreneurial mindset experience in startup environment preferred a plus <p> <p> Deeply analytical systems thinker focused on finding scalable solutions <p> <p> <p> <p> <p> <p> <p> <p> $90000 $110000 a year <p> <p> <strong> Why Youll Love Working At Vial <strong> <p> <p> <p> <p> <strong> We are innately curiosity <strong> We found our calling in clinical trials after learning the pain points directly It is our curiosity that propels us to keep building finding new challenges and fulfilling our vision of reimagining clinical trials <p> <p> <strong> We believe in autonomy <strong> Team members do their best work when given autonomy In order to make an impact on the scale of the Vial vision we built our culture to enable each Vial team member to feel ownership of their domain <p> <p> <strong> We take pride in building mastery <strong> We believe in building master in a craft Craftsmanship a pride in ones craft is key to prolonged engagement on a difficult challenge Vials culture is one of highly autonomous deeply focused experts working on an immensely hard problem together <p> <p> <strong> Our strength is moving fast and staying humble <strong> We believe that if we build a team that is intellectually honest that we stay nimble and keep an open mind to all solutions well be adaptive and solve the problems that face us at every turn <p> <p> <p> <p> <strong> Benefits <strong> <em> Not applicable to Contract or Temp Positions <em> <p> <p> Competitive Equity Compensation <p> <p> Comprehensive benefits package including Medical Dental and Vision insurance <p> <p> 401k or RRSP Plan with Company Matching after first 90 days of employment <p> <p> One time Remote Office Setup Stipend <p> <p> Paid Parental Leave <p> <p> RemoteFirst Flexible Work Schedule <p> <p> Unlimited Vacation <p> <p> <p><p>

Director - Corporate FP&A

Company: Icertis

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <p> With unmatched technology and categorydefining innovation Icertis pushes the boundaries of whats possible with contract lifecycle management CLM The AIpowered analystvalidated Icertis Contract Intelligence ICI platform turns contracts from static documents into strategic advantage by structuring and connecting the critical contract information that defines how an organization runs Today the worlds most iconic brands and disruptive innovators trust Icertis to fully realize the intent of their combined 10 million contracts worth more than $1 trillion in 40+ languages and 93 countries <p> <p> <p> <p> <strong> Who we are <strong> Icertis is the only contract intelligence platform companies trust to keep them out in front now and in the future Our unwavering commitment to contract intelligence is grounded in our FORTE valuesFairness Openness Respect Teamwork and Executionwhich guide all our interactions with employees customers partners and stakeholders Because in our mission to be the contract intelligence platform of the world we believe how we get there is as important as the destination <p> <p> <p> <p> As the Director of FPampA you will play a critical leadership role you will work closely with all of companys functional leaders and bring key market strategic and operational insights that will shape the direction of the company and accelerate its growth You will also play a key role in telling the companys financial story to investors <p> <p> <p> <p> The ideal candidate will have a proven trackrecord of driving business outcomes through keen financial insight and business modeling They will have the ability to create a 360degree financial picture of the business that reflects and influences the companys strategy and be excellent at communicating with senior leaders and executives They will be toolsavvy with experience in creating scalable data and reporting solutions that support a datadriven culture LIRS1 <p> <p> <p> <p> <p> <p> <strong> What you will do <strong> <p> <ul> <li> <p> Formulate a robust 360degree financial picture of the business complete with market insights and operational drivers <p> <li> <li> <p> Develop and maintain the 3year Strategic Planning Model and forecast <p> <li> <li> <p> Deliver Global PampL and cash flow forecasts <p> <li> <li> <p> Drive Annual Planning Process work cross functionally to build and maintain the Annual Financial Plan and Departmental Budgets <p> <li> <li> <p> Build and deliver Business Performance ReportingOperating dashboards <p> <li> <li> <p> Perform strategic business analysis as needed MampA Geo Expansion <p> <li> <li> <p> Prepare financial analyses as needed to help drive improvements in the business Current focus areas include market expansion opportunities competitive benchmarking analyses pricing and strategic financial optimization strategies <p> <li> <li> <p> Partner with Controller to enhance and accelerate the financial reporting process <p> <li> <li> <p> Identifies and implements system and process improvements to increase the efficiency and effectiveness of planning and reporting workflows <p> <li> <li> <p> Prepare communications to Board of Directors <p> <li> <li> <p> Drive investor presentations and supporting analysis <p> <li> <li> <p> Develop a deep understanding of the business metrics with an eye towards understanding the benefits and risks from a financial perspective and helping to manage key business drivers and desired outcomes <p> <li> <li> <p> Play a key role in preparation of critical public financial documents to support the IPO process including working with bankers and supporting the production of investor materials and SEC filings eg S1 <p> <li> <ul> <p> <p> <p> <strong> What you will bring <strong> <p> <ul> <li> <p> 12+ years of experience of working in direct strategic analysis support of all aspects of the business at all areas of the PampL <p> <li> <li> <p> MBACPA or equivalent experience preferred <p> <li> <li> <p> Demonstrated complex modeling experience this is a handson role and managers are expected to directly contribute and lead by example <p> <li> <li> <p> Highly analytical detailoriented with a commitment to creating a highquality product Naturally inquisitive and able to extract information from various sources to identify and understand the underlying issue Not afraid to question results <p> <li> <li> <p> Prior success working in a fastpaced entrepreneurial environment takes initiative and works independently <p> <li> <li> <p> Working knowledge of accounting principles required including revenue recognition amortization and accrual vs cash accounting Must have a general understanding of financial statements <p> <li> <li> <p> Must have exceptional written visual and spoken communication skills <p> <li> <li> <p> Experience in preparing and delivering executive board and investor level communications <p> <li> <li> <p> IPO experience is a plus <p> <li> <li> <p> Must have advanced Excel Netsuite and Powerpoint skills <p> <li> <li> <p> Experience implementing financial analysis and planning tools required <p> <li> <ul> <p> <p> <p> <p> <p> $146000 $219000 a year <p> <p> <em> Pay offered will vary based on jobrelated factors such as location experience training skills and abilities In addition to the base salary and annual bonus target and an equity component is included in the compensation package <em> <p> <p> <strong> What we offer <strong> <p> <p> We are committed to the health and wellbeing of all Icertians their families the communities they live in and our customers This commitment is represented in the Icertis Four Rings of Responsibility Take Care of Self Take Care of Family Take Care of Community and Take Care of Business in that order <p> <p> <p> <p> To support these commitments Icertis offers excellent health and welfare benefits a generous 401k match and a robust paid time off program Here are some of the other reasons <a class=fontbold underline fontbold underline postingslink href=httpswwwicertiscomcompanynewsicertisplacesfirstinwashingtons100bestcompaniestoworkfor rel=noopener noreferrer nofollow target=blank> Icertis Places First in Washingtons 100 Best Companies to Work For | Icertis <a> <p> <p> <p> <p> ● Equity RSUs and shared ownership in the company <p> <p> ● Flexible work environment <p> <p> ● Paid maternity and paternity leave <p> <p> ● 7 Days for Humanity 7 paid volunteer days <p> <p> ● Generous holidays including the 4th of July week off paid <p> <p> ● Free professional and leadership coaching <p> <p> ● Annual personal development allowance <p> <p> <p> <p> Icertis Inc provides Equal Employment Opportunity to all employees and applicants for employment without regard to race color religion gender identity or expression sex sexual orientation national origin age disability genetic information marital status amnesty or status as a covered veteran in accordance with applicable federal state and local laws Icertis Inc complies with applicable state and local laws governing nondiscrimination in employment in every location in which the company has facilities If you are in need of accommodation or special assistance to navigate our website or to complete your application please send an email with your request to <a class=fontbold underline fontbold underline postingslink href=mailtocareersicertiscom rel=noopener noreferrer nofollow target=blank> careersicertiscom <a> or get in touch with your recruiter <p> <p> <p> <p> By submitting your application you acknowledge that you have read Icertiss Privacy Policy <a class=fontbold underline fontbold underline postingslink href=httpswwwicertiscomprivacystatement rel=noopener noreferrer nofollow target=blank> httpswwwicertiscomprivacystatement <a> <p> <p> <p> <p> Icertis is not open to third party solicitation or resumes for our posted FTE positions Resumes received from third party agencies that are unsolicited will be considered complimentary <p><p>

Sr. Manager Customer Success Operations

Company: Vercel

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <h2> About Vercel <h2> <p> Vercels Frontend Cloud provides the developer experience and infrastructure to build scale and secure a faster more personalized web Customers like Under Armour eBay The Washington Post Johnson amp Johnson and Zapier use Vercel to build dynamic user experiences on the web <p> <p> At Vercel our mission is to enable the world to ship the best products and that goes hand in hand with creating an environment where you can do the best work of your life <p> <h2> <strong> About the Role <strong> <h2> <p> The Senior Manager Customer Success Operations is a crucial support role for our customer success leadership and team Responsibilities include developing and maintaining systems processes and analysis to gauge customer health enhance team efficiency and identify strategies for longterm Net Dollar Retention NDR growth If you excel in optimizing operations and leveraging data for strategic insights this role is an exciting opportunity to drive customer success and contribute to sustained business growth <p> <h2> <strong> What You Will Do <strong> <h2> <ul> <li> <p> Advise and partner with Customer Success leaders leveraging insights and analytics to refine and advance our gotomarket strategy <p> <li> <li> <p> Oversee and analyze key operational metrics within the Customer Success team to drive continuous improvement and decisionmaking <p> <li> <li> <p> Drive accurate forecasting of renewals and expansions implement strategies and processes to better predict performance <p> <li> <li> <p> Lead the the selection and refinement of tools systems and processes that empower the Customer Success team to deliver impactful customer outcomes effectively <p> <li> <li> <p> Design and deploy systems and programs to support the timely delivery and billing of Professional Services <p> <li> <li> <p> Create and deploy initiatives to improve the effectiveness and efficiency of the Customer Support organization <p> <li> <li> <p> Develop and deliver strategic programs to improve our high CSAT and NPS scores in line with our commitment to bestinclass customer service <p> <li> <ul> <h2> <strong> About You <strong> <h2> <ul> <li> <p> 5+ years of experience leading Customer Success Operations or GTM Operations teams at Saas companies <p> <li> <li> <p> Demonstrated experience leading customer success field teams Customer Success Managers Account Management Professional Services Solution Architects <p> <li> <li> <p> Proven track record of designing implementing and optimizing automated customer success workflows <p> <li> <li> <p> Experience using data and metrics to drive improvements <p> <li> <li> <p> Strong verbal and written skills with a passion for documentation <p> <li> <ul> <h2> Benefits <h2> <ul> <li> <p> Great compensation package and stock options <p> <li> <li> <p> Inclusive Healthcare Package <p> <li> <li> <p> Learn and Grow we provide mentorship and send you to events that help you build your network and skills <p> <li> <li> <p> Flexible Time Off Flexible vacation policy with a recommended 4weeks per year and paid holidays <p> <li> <li> <p> Remote Friendly Work with teammates from different time zones across the globe <p> <li> <li> <p> We will provide you the gear you need to do your role and a WFH budget for you to outfit your space as needed <p> <li> <ul> <p> The San Francisco CA pay range for this role is $16700000 $20000000 This salary range is an estimate Actual salary will be based on job related skills experience and location Pay ranges outside San Francisco may be adjusted based on employee location The total compensation package also includes benefits and equitybased compensation Your recruiter can share more about the specific pay range for your location during the hiring process <p> <p> Vercel is committed to fostering and empowering an inclusive community within our organization We do not discriminate on the basis of race religion color gender expression or identity sexual orientation national origin citizenship age marital status veteran status disability status or any other characteristic protected by law Vercel encourages everyone to apply for our available positions even if they dont necessarily check every box on the job description LIDNI <p><p>

Brand Designer - Brand Studio

Company: Figma

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <p> Were seeking a Brand Designer to join the Figma Brand Studio a multidisciplinary group of designers makers and strategists This passionate team gives shape to the ways Figma shows up and interacts with the world through brand touchpoints marketing efforts and social channels This person will support our mission of delivering worldclass creative brand experiences and content that set the bar for quality We value those that are curious collaborative and egofree <p> <p> <p> <p> As a Brand Designer you will conceptualize and craft a variety of creative solutions across many mediums and surfaces including our website social channels and events This is a highly collaborative role where you will partner closely with GoToMarket teams giving shape to projects that build awareness of the Figma brand and product benefits in engaging and novel ways Working with the rest of the studio youll play an essential role in maintaining and evolving the Figma brand Youre a strong clear communicator and a natural problem solver providing a critical eye to the level of detail polish craft and consistency in our overall output The ideal candidate for this role is selfmotivated mediumagnostic willing to help out on any project loves a creative challenge and is excited about growing in their craft <p> <p> <p> <p> <em> This is a full time role that can be held from one of our US hubs or remotely in the United States <em> <p> <h3> What youll do at Figma <h3> <ul> <li> <p> See projects throughout the entire design process from creative conception to production <p> <li> <li> <p> Craft engaging visuals and digital experiences in a fastpaced environment <p> <li> <li> <p> Design for a wide range of projects while ensure consistency of the Figma brand across many surfaces including our website social channels and events <p> <li> <li> <p> Actively contribute to the evolution of the Figma brand by exploring novel solutions that support our brand and marketing goals <p> <li> <li> <p> Collaborate with marketing product design and growth teams to concept campaigns evergreen communications and launch announcements that support new products and features <p> <li> <ul> <h3> Wed love to hear from you if you have <h3> <ul> <li> <p> A strong portfolio showcasing brand experience across a range of mediums <p> <li> <li> <p> Excellence in typography color layout and composition <p> <li> <li> <p> Strong visual storytelling skills that support launching new and emerging product features in novel ways <p> <li> <li> <p> Deep understanding of current UIUX trends craft and patterns <p> <li> <li> <p> Effectively communicate concepts and design rationale <p> <li> <li> <p> Embrace an iterative design process and receptive to feedback <p> <li> <li> <p> Able to work independently drive multiple projects at a time and iterate quickly <p> <li> <li> <p> Foster strong working relationships with team members and crossfunctional partners <p> <li> <li> <p> Comfortable in your soft skills listening negotiating and decisionmaking <p> <li> <ul> <p> At Figma one of our values is Grow as you go We believe in hiring smart curious people who are excited to learn and develop their skills If youre excited about this role but your past experience doesnt align perfectly with the points outlined in the job description we encourage you to apply anyways You may be just the right candidate for this or other roles <p><p>

Distributed Systems Engineer, L5 - OC Tools Runtime

Company: Netflix

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <p> How do you spark joy in hundreds of millions of people It starts with a vision that technology can give voice to stories around the world In delivering those muchloved stories Netflix is responsible for a significant portion of global internet traffic <p> <p> <p> <p> To steward that responsibility we work collaboratively with ISPs to deploy <a class=fontbold underline fontbold underline postingslink href=httpsmedianetflixcomencompanybloghownetflixworkswithispsaroundtheglobetodeliveragreatviewingexperience rel=noopener noreferrer nofollow target=blank> Open Connect <a> Netflixs Content Delivery Network CDN which delivers 100 of Netflixs video traffic Our teams mission is to support that delivery by providing an automation and tooling platform that supports the internal operations and external partnerships needed to provide a fantastic viewing experience for all Netflix members We are looking for a talented software engineer specializing in infrastructure to join us on that mission <p> <p> <p> <p> <strong> The Role <strong> <p> <p> You will be charged with handling impactful availability scalability and usability challenges and must selfdefine optimal ways to configure manage and observe our growing Open Connect platform Our platform is a fundamental building block to our streaming initiatives providing critical solutions for one of the worlds largest CDNs and empowering stakeholders to operate the CDN more efficiently and reliably <p> <p> <p> <p> <p> <p> <p> <p> <strong> In this position you will have the opportunity to work in a wide variety of areas such as <strong> <p> <ul> <li> <p> Implementing microservices to enable analytics insights discovery and visualizations <p> <li> <li> <p> Designing orchestration to manage many thousands of globally distributed appliances and devices <p> <li> <li> <p> Building data models and APIs to help manage and maintain our fleet <p> <li> <li> <p> Understanding the breadth of our multitenant platform creating generalized solutions which can be leveraged across multiple domains including networking video and gaming <p> <li> <ul> <p> <p> <p> <strong> You Are <strong> <p> <ul> <li> <p> Someone who likes to work handson and selfdirect in a fastpaced environment that gives you great freedom and responsibility <p> <li> <li> <p> Able to see beyond immediate specifications can summarize requirements and architect forwardlooking solutions that cross multiple applications <p> <li> <li> <p> Capable of working in a highlycollaborative environment alongside your teammates engineers Partner Engagement Managers project managers and operations teams <p> <li> <li> <p> Articulate in communicating opportunities for continuous improvements to existing systems with a clear understanding of the impact on the business <p> <li> <li> <p> Always striving to develop and deploy in measured increments while taking responsibility for the quality of your work <p> <li> <ul> <p> <p> <p> <strong> Required Skills <strong> <p> <ul> <li> <p> 5+ years of expertise in Java or similar objectoriented language with confidence and experience in debugging and problemsolving skills <p> <li> <li> <p> Deep understanding of cloud architecture and application deployment <p> <li> <li> <p> Ability to build and support highly scalable robust and faulttolerant services <p> <li> <li> <p> Comprehensive knowledge of architecting and maintaining largescale distributed systems while handling high concurrency <p> <li> <li> <p> Experience designing implementing and debugging systems that interact with largesized data sets <p> <li> <li> <p> Excellent verbal and written communication skills <p> <li> <ul> <p> <p> <p> <strong> Bonus Skills <strong> <p> <ul> <li> <p> Knowledge of CDN architectures and networking fundamentals TCPIP BGP DNS <p> <li> <li> <p> Experience with multiple data stores and streaming services such as MySQL Postgres Elasticsearch Cassandra Kafka or Redis <p> <li> <li> <p> Familiarity with GraphQL or related graph modeling and querying concepts <p> <li> <li> <p> Handson Big Data experience using Hive Pig Hadoop or similar <p> <li> <li> <p> Understanding of frontend technologies including HTML CSS JavaScript WebSockets <p> <li> <ul> <p> <p> <p> <p> <p> Does this sound interesting Or does this sound interesting but intimidating Please dont selfselect out lets figure it out together Wed love to talk to you <p> <p> <p> <p> Our culture is unique and we tend to live by our values so its worth learning more about Netflix <a class=fontbold underline fontbold underline postingslink href=httpsjobsnetflixcomculture rel=noopener noreferrer nofollow target=blank> here <a> <p> <p> <p> <p> Our compensation structure consists solely of an annual salary we do not have bonuses You choose each year how much of your compensation you want in salary versus stock options To determine your personal top of market compensation we rely on market indicators and consider your specific job family background skills and experience to determine your compensation in the market range The range for this role is $100000 $720000 <p> <p> <p> <p> Netflix provides comprehensive benefits including Health Plans Mental Health support a 401k Retirement Plan with employer match Stock Option Program Disability Programs Health Savings and Flexible Spending Accounts Familyforming benefits and Life and Serious Injury Benefits We also offer paid leave of absence programs Fulltime hourly employees accrue 35 days annually for paid time off to be used for vacation holidays and sick paid time off Fulltime salaried employees are immediately entitled to flexible time off See more detail about our Benefits <a class=fontbold underline fontbold underline postingslink href=httpsjobsnetflixcomworklifephilosophy rel=noopener noreferrer nofollow target=blank> here <a> <p> <p> <p> <p> Netflix is a unique culture and environment Learn more <a class=fontbold underline fontbold underline postingslink href=httpsjobsnetflixcomculture rel=noopener noreferrer nofollow target=blank> here <a> <p> <p> <p> <p> We are an equalopportunity employer and celebrate diversity recognizing that diversity of thought and background builds stronger teams We approach diversity and inclusion seriously and thoughtfully We do not discriminate on the basis of race religion color ancestry national origin caste sex sexual orientation gender gender identity or expression age disability medical condition pregnancy genetic makeup marital status or military service <p><p>

Senior iOS Software Engineer

Company: Empower

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <p> <strong> EMPOWER OVERVIEW <strong> <p> <p> <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpempowerme rel=noopener noreferrer nofollow target=blank> Empower <a> is a highgrowth financial technology company on a mission to expand access to fair credit to give anyone in the world the opportunity to improve their financial security and mobility We dream up and launch oneofakind features that help our members get money instantly whenever they need it save for the future and rewrite their financial story Our members see Empower Cash Advance as a lifesaver Empower Automatic Savings as a gamechanger and the new Empower Thrive line of credit currently in beta launching soon as a lifeline to lowcost borrowing and the only practical path to building good credit <p> <p> <p> <p> Empower is backed by Sequoia Capital Blisce and Icon Ventures Are we the next great place to grow your impact and accelerate your career We think so <p> <p> <p> <p> Inc ranked Empower 56 in the 2023 Inc 5000 list of the fastestgrowing private companies in the US 55 in 2022 Forbes put Empower on its 2023 list of Americas Best Startup Employers Fast Company recognized the new Empower Thrive line of credit in their 2022 list of the Next Big Things in Tech <p> <p> <p> <p> <strong> THE EMPOWER WAY <strong> <p> <p> <strong> Great Expectations <strong> We come up with bold audacious goals for ourselves and go all out for impact <p> <p> <strong> Owner Mindset <strong> We give every employee latitude to act independently make smart choices and move the business forward <p> <p> <strong> Spirited Debate <strong> We love skeptics and seek counter opinions to challenge our personal assumptions and expand our view <p> <p> <strong> Customer Obsession <strong> We listen to understand empathize and create a memorable rewarding experience for our community <p> <p> <strong> Inclusive Collaboration <strong> We believe diverse teams make the best decisions and we strive to give diverse voices a seat at the table <p> <p> N <strong> o Jerks Allowed <strong> We value our relationships and take the time to build trust and connection and communicate respectfully <p> <p> <p> <p> <strong> <strong> <p> <p> <strong> WHAT EMPOWER OFFERS <strong> <p> <p> <p> <p> Competitive salary <p> <p> Generous equity package <p> <p> Full healthcare and dental benefits <p> <p> Technology expense reimbursement <p> <p> Work from anywhere <p> <p> <p> <p> <strong> JOB DESCRIPTION <strong> <p> <p> As an iOS Software Engineer youll create the iOS mobile app that powers the Empower customer experience Youll engage with a collaborative high powered team to develop solutions and lead product engineering on projects with a reach of millions The solutions youll build will be robust secure and easy to understand both for our users and your engineering peers Youll take end to end ownership of new features and product lines shaping work in early stages building deploying and running post deployment analysis to ensure were hitting our goals <p> <p> <p> <p> <p> <p> Travel for company offsites is expected at a minimum 2 times a year <p> <p> <p> <p> <p> <p> <strong> Key Responsibilities <strong> <p> <ul> <li> <p> Designing and building iOS mobile apps <p> <li> <li> <p> Contribution and adherence to software engineering standards and practices <p> <li> <li> <p> Implementing secure coding standards in accordance with the Empower Secure Development Policy <p> <li> <li> <p> Perform ongoing security testing and code review to improve software security <p> <li> <li> <p> Meeting sprint goals <p> <li> <li> <p> Leading andor supporting feature specification activities Product Engineering <p> <li> <li> <p> Monitoring the performance of the Empower mobile app and applying corrective action through bug fixing and general improvement <p> <li> <li> <p> Minimizing defects and improving reliability through Development of automated tests manual test validation development of fit for purpose architecture and code contributing to PRs <p> <li> <li> <p> Developing and maintaining the iOS app build pipeline <p> <li> <li> <p> Publishing the App to the App Store <p> <li> <li> <p> Collaborating crossfunctionally to define design and ship new features that create customer and business value <p> <li> <li> <p> Playing an active role in advising and collaborating with design and product to flesh out the specifications of each epic <p> <li> <li> <p> Writing engineering specs including acceptance criteria and server contracts <p> <li> <li> <p> Grooming stories for upcoming sprints <p> <li> <li> <p> Maximising effective development and identifying new technology opportunities by Keeping across iOS development announcements being across community best practice discovering and evaluating new technologies <p> <li> <ul> <p> <p> <p> <strong> Candidate Qualifications <strong> <p> <ul> <li> <p> Bachelor degree or greater within Computer Science Software Engineering or a related subject <p> <li> <li> <p> 5+ years developing consumer facing iOS apps <p> <li> <li> <p> Working experience in Swift and iOS UI Frameworks <p> <li> <ul> <p> <p> <p> <p> <p> At Empower we hire for people that push themselves to understand others and seek out ways to challenge their personal assumptions Our hope is that by fostering such an environment we strengthen our business and relationships by putting people first We are committed to building a diverse inclusive and equitable workspace where everyone regardless of age education ethnicity gender sexual orientation or any personal characteristics feels like they belong Even if your experience doesnt exactly match up to our job description you should feel empowered to apply regardless <p><p>

Customer Experience and Insights Manager - Enterprise

Company: Upwork

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <p> Upwork $UPWK is the worlds work marketplace We serve everyone from oneperson startups to large Fortune 100 enterprises with a powerful trustdriven platform that enables companies and talent to work together in new ways that unlock their potential <p> <p> Last year more than $38 billion of work was done through Upwork by skilled professionals who are gaining more control by finding work they are passionate about and innovating their careers <p> <p> If youre an experienced CX leader whos ready to use data storytelling and insights to drive our teams to improve customers lives then this may be your dream job As the Customer Experience Manager for Upworks Enterprise Business Unit you will lead our VoC Voice of Customer function for Upworks Enterprise clients This role owns Enterprise VoC endtoend and will work with key stakeholders to ensure we are hearing from our customers throughout their journey and lifecycle You will report to the Director Customer 360 Advocacy <p> <h3> <strong> Your Responsibilities <strong> <h3> <ul> <li> <p> <strong> Drive VoC data collection <strong> Run our Enterprise NPS survey and partner with Enterprise stakeholders and product managers to identify opportunities for additional listening posts to capture customer feedback <p> <li> <li> <p> <strong> Build our VoC Enterprise journey maps <strong> Identify gaps in our understanding of the Enterprise experience to help us create a comprehensive 360° view of these customer journeys <p> <li> <li> <p> <strong> Interpret data <strong> Dive into data across sources from NPS surveys to everything in our natural language processing vendor unitQ to identify themes at scale and extrapolate statistically significant insights <p> <li> <li> <p> <strong> Communicate with strategic focus amp clarity <strong> Employ exceptional communication skills to deliver quantifiable and actionable insights to teammates leaders and stakeholders at various levels of the business <p> <li> <li> <p> <strong> Empathetic storytelling <strong> Engage both the head and heart for our Enterprise product leaders and teams providing them the understanding they need to prioritize and accomplish our customer experience goals <p> <li> <li> <p> <strong> Make prioritized and compelling recommendations <strong> Influence product roadmaps through compelling datadriven storytelling and business cases using operational customer and financial data so outputs meet business needs and are strategically aligned <p> <li> <li> <p> <strong> Learn the Enterprise product <strong> become an expert in the Upwork Enterprise product from the customers perspective <p> <li> <li> <p> <strong> Insights to action <strong> Manage our customer experience database for all Enterprise experiences ensuring all pain points are captured categorized and prioritized for product teams to take action <p> <li> <li> <p> <strong> Closedloop methodologies <strong> Educate and empower Enterprise teams to closetheloop with our customers including issue resolution prevention and communication <p> <li> <li> <p> <strong> Systems thinker <strong> Zoom out to see the big picture and dive into the details when appropriate keeping a pulse on the organizations larger strategy <p> <li> <ul> <h3> <strong> What it Takes to Catch our Eye <strong> <h3> <ul> <li> <p> Certified Customer Experience Professional CCXP <p> <li> <li> <p> Proven track record driving positive change in a complex environment <p> <li> <li> <p> Understands CX methods and tools ex NPS CES closedloop systems journey mapping <p> <li> <li> <p> Group facilitation skills with experience running internal workshops andor external customer advisory boards <p> <li> <li> <p> Experience delivering insights reports to crossfunctional teams including ability to provide direction while not having direct authority <p> <li> <li> <p> Growth mindset and a curiosity to lean into the latest industry data and best practice <p> <li> <ul> <h3> <strong> Come change how the world works <strong> <h3> <p> At Upwork youll shape talent solutions for how the world works today We are a remotefirst organization working together to create exciting remote work opportunities for a global community of professionals While we have physical offices in San Francisco and Chicago currently we also support hiring of corporate fulltime employees in 19 states in the United States Please speak with a member of our recruitment team to determine whether you are located in a state in which we are hiring corporate fulltime employees <p> <p> At the core of our vibrant culture are shared values that form the foundation of our organization These values revolve around trust risktaking customer focus and excellence Our overarching mission is to create economic opportunities so that people have better lives We foster an environment where individuals are encouraged to bring their authentic selves to work nurturing personal and professional growth through development opportunities mentorship programs and participation in Upwork Belonging Communities <p> <p> We take pride in providing exceptional benefits to our employees These include comprehensive medical insurance coverage for both you and your family unlimited paid time off a 401k plan with matching contributions 12 weeks of paid parental leave and an Employee Stock Purchase Plan To explore these benefits in detail as well as gain insights into our company values working principles and the overall employee experience we invite you to visit our <a class=fontbold underline fontbold underline fontbold underline href=httpswwwupworkcomcareerslifeatupwork rel=noopener noreferrer nofollow target=blank> Life at Upwork page <a> <p> <p> Upwork is proudly committed to recruiting and retaining a diverse and inclusive workforce As an Equal Opportunity Employer we never discriminate based on race religion color national origin gender including pregnancy childbirth or related medical condition sexual orientation gender identity gender expression age status as a protected veteran status as an individual with a disability or other applicable legally protected characteristics <p> <p> LIRemote <p><p>

Enterprise Account Executive

Company: Praxis Labs

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <p> As a fast growing missiondriven startup we are looking to grow our Sales team by bringing on an Enterprise Account Executive to continue our momentum and success within Enterprise Accounts <p> <h3> <strong> Role amp Responsibilities <strong> <h3> <ul> <li> <p> Be the face of our product to new customers by helping to guide them in improving their workplace <p> <li> <li> <p> Youll build our relationships and community to a diverse set of industries customers and workforces <p> <li> <li> <p> Create and refine systems and processes to assist in optimizing processes for prospecting and solution development <p> <li> <li> <p> Manage and support the performance and development of your team members help them grow into experts in the field <p> <li> <li> <p> Partner with Marketing on thought leadership opportunities and in field activities eg blogs events conferences <p> <li> <li> <p> Establish strong partnerships with CS Product and crossfunctional teams to grow Praxis Labs <p> <li> <li> <p> Articulate and create Praxis Labs business value through engaging executive level presentations <p> <li> <ul> <h3> <strong> Ideal Qualifications <strong> <h3> <ul> <li> <p> 5+ years of experience selling and closing SaaS technology or other business applications to large enterprises <p> <li> <li> <p> Experience selling to Clevel executives and preferably having an understanding of the HR or LampD landscape and existing challenges and solutions <p> <li> <li> <p> Ability to define and execute the entire sales lifecycle and preferably familiar with Command of the Message or other value selling methodologies <p> <li> <li> <p> Ability to prioritize and discover new opportunities within customer and new logo accounts <p> <li> <li> <p> Cares deeply about diversity equity inclusion and justice and is a conscious and inclusive leader comfortable talking about DEIJ topics <p> <li> <li> <p> Lives Praxis Labs values of being vocal clear communicator being generous with time with feedback be praxis data driven be brave unafraid to try and fail and be openminded seeks out diverse perspectives and be curious asks questions seeks to learn <p> <li> <li> <p> Is comfortable and not easily overwhelmed in a fastpaced role and missiondriven environment <p> <li> <ul> <p> <em> The pay range for this position at the start of employment is expected to be between <em> <strong> <em> $220000 $270000 salary+commission <em> <strong> <em> However the base pay offered may vary depending on multiple factors including jobrelated knowledge skills experience market factors location and business need <em> <p><p>

Senior Software Engineer - AI

Company: Synack

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <p> At Synack we create technology that unleashes the best cybersecurity talent to secure our digital world <p> <p> We protect leading global organizations by reducing companies security risk and increasing their resistance to cyber attack How do we do this By utilizing the worlds best and most trusted team of ethical hackers who test through our powerful and controlled platform to deliver real security without compromise <p> <p> Backed by toptier venture capital firms including Kleiner Perkins Caufield amp Byers Microsoft and Google Ventures Synacks mission is to leverage global security talent coupled with advanced technology to help enterprises discover security vulnerabilities before they become business problems Discover the possibilities at Synack <p> <p> We are looking for a Senior Software Engineer AI where youll be spearheading the development of cuttingedge AIdriven solutions tailored for the offensive security sector This role demands a handson approach to designing developing and deploying machine learning models that address specific cybersecurity challenges enhancing our product offerings and meeting our customers critical needs Youll lead by example mentoring junior engineers and promoting a culture of technical excellence innovation and continuous improvement <p> <p> Sounds interesting Keep reading <p> <p> <strong> Please note <strong> This is a remote position based in the US We can only hire US citizens for this position due to federal government contract requirements <p> <p> <p> <p> <strong> Heres what youll do <strong> <p> <ul> <li> <p> Design implement and deliver scalable AI and machine learning solutions <p> <li> <li> <p> Develop robust AI models capable of identifying vulnerabilities automating penetration testing processes workflow optimization and enhancing threat intelligence <p> <li> <li> <p> Own and drive the endtoend development of AI product features from ideation to deployment monitoring and model management <p> <li> <li> <p> Actively participate in and contribute to design and implementation of AI solutions promoting best practices during the project lifecycle <p> <li> <li> <p> Lead technical discussions code reviews and design sessions sharing your expertise to uplift the teams capabilities <p> <li> <li> <p> Provide mentorship and support to junior engineers encouraging professional growth and development <p> <li> <li> <p> Collaborate closely with crossfunctional teams to integrate AI capabilities into broader systems and applications <p> <li> <ul> <p> <strong> Heres what youll need <strong> <p> <ul> <li> <p> 10+ years of experience in machine learning engineering with a strong foundation in statistics mathematics or a related field <p> <li> <li> <p> 3+ years of demonstrated experience in designing and implementing machine learning models and data pipelines in production environments <p> <li> <li> <p> Excellent problemsolving skills with the ability to translate complex business requirements into technical solutions <p> <li> <li> <p> Strong communication skills capable of presenting findings and insights to both technical and nontechnical audiences <p> <li> <li> <p> Proficient in Python and strong understanding of AI and machine learning algorithms and frameworks eg Tensorflow PyTorch <p> <li> <li> <p> Strong knowledge of data management systems both SQL eg PostgreSQL and NoSQL egMongoDB <p> <li> <li> <p> Demonstrated ability to work effectively in a teamoriented collaborative environment <p> <li> <ul> <p> <strong> Nice To Have <strong> <p> <ul> <li> <p> Expertise in AI and ML technologies especially Azure AI and Open AI demonstrating the ability to integrate into software solutions <p> <li> <li> <p> Interest or experience in Cyber Security <p> <li> <ul> <p> <strong> Ready to join us <strong> <p> <p> Synack is committed to embracing diversity Our people are our strength Each addition to our team is an opportunity to grow and diversify our ideas experiences and viewpoints We strive to be inclusive of Race Ethnicity Religion Sex LGBTQ+ Veterans Disabilities and Age Synack welcomes you <p> <p> As a candidate Synack cares about your privacy Please view our candidate privacy policy <a class=fontbold underline fontbold underline fontbold underline href=httpswwwsynackcomcandidateprivacynotice rel=noopener noreferrer nofollow target=blank> here <a> <p> <p> <strong> $145000 $235000 py <strong> Salary is determined by a combination of factors including location level relevant experience and skills The range displayed on each job posting reflects the minimum and maximum target for new hire salaries for the position across all US locations The compensation package for this position may also include equity and benefits For more details about our benefits please see <a class=fontbold underline fontbold underline fontbold underline href=httpssynackmybenefitslife rel=noopener noreferrer nofollow target=blank> here <a> Then for the Employer code enter <strong> synack <strong> <p><p>

Payor Success & Relations Partnerships Manager

Company: Grow Therapy

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <p> <strong> What Youll Be Doing <strong> <p> <p> Were looking for an experienced Partnerships Manager for our Insurance Operations team who is passionate about improving the landscape for mental healthcare You will lead our strategic partnerships with insurance companies within our Payor Success and Relations department You will be responsible for developing and strengthening relationships with new and existing partners as well as executing on new and existing engagement opportunities You will also play an essential role as liaison in ensuring that our credentialing data analytics and revenue cycle management teams have the appropriate infrastructure in place to grow our provider base get our providers innetwork with insurance companies and obtain reimbursement for services to enable continued engagement and growth Youll thrive in this role if you are a master communicator and endlessly curious with a love for crossfunctional learning and collaboration as well as datainformed storytelling As you get to know our internal systems and processes better youll have the opportunity to expand your impact into different areas of the business and youll eventually become the goto person for a myriad of responsibilities pertaining to our partners unique needs <p> <ul> <li> <p> Lead key partnership implementation workstreams including new partnership development expansion of existing partnerships and collaboration with internal and external crossfunctional partners Internal teams include Growth Customer amp Client Support Tech and other Insurance Operations teams <p> <li> <li> <p> Lead implementation of new opportunities for partnerships at Grow and act as the subject matter expert on partner KPIs <p> <li> <li> <p> Develop creative strategies to deepen our existing relationships with partners that are of high value to our organization and mission <p> <li> <ul> <p> <em> Salary range $116000 $140000 <em> <p> <p> <strong> Youll Be a Good Fit If <strong> <p> <ul> <li> <p> Empathetic Leader You have a strong track record of building high performing teams cross functionally Can intuit the needs of external partners before theyre even shared Ability to performance manage individual team members when necessary <p> <li> <li> <p> Detail Oriented Youre a meticulous reviewer of your own and others work <p> <li> <li> <p> Problem Solver Youre able to identify business challenges based on metrics and analyses and youre ready to recommend solutions to improve business processes <p> <li> <li> <p> MissionDriven Youre here to change the world and youre always connecting your work back to the importance of the Grow Therapy mission <p> <li> <li> <p> Agile You thrive in a fastpaced unpredictable environment and youre able to pivot as new priorities emerge <p> <li> <li> <p> Team Player Youre collaborative by nature relish in camaraderie and group wins and are looked to by your colleagues as a steadfast partner and source of encouragement <p> <li> <li> <p> Passionate Storyteller Youre good at transforming dashboards and other data insights into a compelling story for our external partners taking into account macro goals of our organization plus those of our partners <p> <li> <li> <p> Master of Project Management Youre a master at juggling multiple initiatives and clear ability to prioritize the most important stuff Highly organized and able to keep projects and priorities on track <p> <li> <ul> <p> <em> If you dont meet every single requirement but are still interested in the job please apply Nobody checks every box and Grow believes the perfect candidate is more than just a resume <em> <p> <p> Note Please upload your resume in PDF format <p><p>

Frequently Asked Questions

What are the typical salary ranges by seniority for Unwavering Mission tech roles?
Entry‑level positions start around $80,000–$100,000 annually. Mid‑level engineers earn $120,000–$150,000. Senior specialists command $150,000–$200,000. Lead or principal roles range $200,000–$250,000, while technical managers or directors can reach $250,000–$300,000, depending on company size and impact scope.
Which skills and certifications are most valuable in this category?
Cloud certifications such as AWS Certified Solutions Architect, GCP Professional Cloud Architect, or Azure Solutions Architect. DevSecOps tools like Kubernetes, Terraform, GitHub Actions, and continuous‑integration pipelines. Security credentials such as CISSP, CISM, or CompTIA Security+. Data‑privacy expertise (GDPR, CCPA) and AI ethics certifications (IEEE P7001) are also highly regarded.
Is remote work available for Unwavering Mission positions?
Yes—most listings support fully remote or hybrid arrangements. Companies often require a reliable internet connection, a secure VPN, and availability for occasional on‑site visits during audits or product launches.
What career progression paths exist within Unwavering Mission roles?
A typical trajectory starts as a junior engineer, advances to senior engineer, then to tech lead or principal engineer. From there, professionals can move into product management, chief technology officer, or director roles, especially in firms that prioritize sustainability and ethical technology.
What industry trends shape Unwavering Mission tech jobs?
Rapid growth in climate‑tech infrastructure, blockchain for supply‑chain transparency, and AI bias‑mitigation tools. Increased regulatory focus on data privacy and cybersecurity, and a surge in remote‑first cultures that demand resilient, low‑latency cloud architectures.

Related Pages