Wellness Program Jobs in USA
366,722 open positions · Updated daily
Looking for Wellness Program jobs in USA? Browse our curated listings with transparent salary information to find the perfect Wellness Program position in the USA area.
Client Development Director - Channel Partnerships
Company: StackAdapt
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> StackAdapt is a selfserve advertising platform that specializes in multichannel solutions including native display video connected TV audio ingame and digital outofhome ads We empower hundreds of digitallyfocused companies to deliver outcomes and exceptional campaign performance everyday StackAdapt was founded with a vision to be more than an advertising platform its a hub of innovation imagination and creativity <p> <p> <p> <p> Are you a proactive problem solver with a passion for programmatic advertising Are you a relationship builder with strong interpersonal communication skills If so then we want to hear from you Were looking for a Client Development Manager to join our expanding Channel Partnerships team in a specialist capacity <p> <p> <p> <p> You will become a foremost expert on the StackAdapt platform while owning the growth and success of enterprise level channel partners post sale The ideal candidate will manage a group of accounts with the goal of exceeding StackAdapts customer success standards building valuable relationships across executive and operator levels and driving new business using a consultative partner based sales approach <p> <p> <p> <p> Successful candidates will be self motivated with a strong track record of quickly understanding client technical needs and business objectives to recommend the right solutions to achieve goals <p> <p> <p> <p> StackAdapt is a Remote First company we are open to candidates located anywhere in the US for this position <p> <p> <p> <p> <p> <p> <strong> What youll be doing <strong> <p> <ul> <li> <p> Act as StackAdapts principle evangelist media thought leader problem solver and point of contact across your account portfolio <p> <li> <li> <p> Accurately forecast business needs and account growth while maintaining a clean pipeline of incremental opportunities <p> <li> <li> <p> Own build and run the rhythm of business across your portfolio through the use of status calls strategy calls office hours QBRs and more <p> <li> <li> <p> Identify and pitch key incremental sales opportunities develop client enablement plans and work cross functionally within StackAdapt to solve client needs and develop new opportunities <p> <li> <ul> <p> <p> <p> <strong> What youll bring to the table <strong> <p> <ul> <li> <p> High level of experience managing enterprise clients within the programmatic advertising space preferably at a Demand Side Platform Trading Desk or Media Agency <p> <li> <li> <p> Comfortable working within a quota based environment with a track record of exceeding targets and successfully growing account portfolios <p> <li> <li> <p> Positive energy proactive mentality highly organized with a growth mindset <p> <li> <li> <p> Bonus if you have worked with API based media clients at a Demand Side Platform <p> <li> <ul> <p> <p> <p> <strong> StackAdapters Enjoy <strong> <p> <ul> <li> <p> Competitive salary + commissions <p> <li> <li> <p> 401K matching <p> <li> <li> <p> 3 weeks vacation + 3 personal care days + 1 Culture amp Belief day + birthdays off <p> <li> <li> <p> Access to a comprehensive mental health care platform <p> <li> <li> <p> Health benefits from day one of employment <p> <li> <li> <p> Work from home reimbursements <p> <li> <li> <p> Optional global WeWork membership for those who want a change from their home office <p> <li> <li> <p> Robust training and onboarding program <p> <li> <li> <p> Coverage and support of personal development initiatives conferences courses etc <p> <li> <li> <p> Access to StackAdapt programmatic courses and certifications to support continuous learning <p> <li> <li> <p> Mentorship opportunities with industry leaders <p> <li> <li> <p> An awesome parental leave policy <p> <li> <li> <p> A friendly welcoming and supportive culture <p> <li> <li> <p> Our social and team events <p> <li> <ul> <p> <p> <p> <p> <p> <p> <p> <p> <p> <em> StackAdapt is a diverse and inclusive team of collaborative hardworking individuals trying to make a dent in the universe No matter who you are where you are from who you love follow in faith disability or superpower status ethnicity or the gender you identify with if youre comfortable let us know your pronouns you are welcome at StackAdapt If you have any requests or requirements to support you throughout any part of the interview process please let our Talent team know <em> <p> <p> <p> <p> <strong> About StackAdapt <strong> <p> <p> <p> <p> Weve been recognized for our diverse and supportive workplace high performing campaigns awardwinning customer service and innovation Weve been awarded <p> <p> <p> <p> <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpsblogstackadaptcomstackadaptnamedadagesbestplacetowork2024utmsource=linkedinamputmmedium=organicsocialamputmcampaign=adagesbestplacetowork2024amputmcontent=blog rel=noopener noreferrer nofollow target=blank> Ad Age Best Places to Work 2024 <a> <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpsblogstackadaptcomg22024bestsoftwareawards rel=noopener noreferrer nofollow target=blank> G2 Top Software and Top Marketing and Advertising Product for 2024 <a> <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpsblogstackadaptcom2023bestplacestoworkuk rel=noopener noreferrer nofollow target=blank> Campaigns Best Places to Work 2023 for the UK <a> <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpsblogstackadaptcombestworkplacesforwomenlist rel=noopener noreferrer nofollow target=blank> 2024 Best Workplaces for Women <a> and <a class=fontbold underline fontbold underline postingslink href=httpsblogstackadaptcom2023bestworkplacesincanadalist rel=noopener noreferrer nofollow target=blank> in Canada <a> by Great Place to Work® <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpswwwg2comproductsstackadaptreviews rel=noopener noreferrer nofollow target=blank> 1 DSP on G2 and leader in a number of categories including CrossChannel Advertising <a> <p> <p> <p> <p> LIRemote <p><p>
Senior Backend Engineer - Shared Services
Company: Webflow
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> At Webflow our mission is to bring development superpowers to everyone Webflow is the leading visual development platform for building powerful websites without writing code By combining modern web development technologies into one platform Webflow enables people to build websites visually saving engineering time while clean code seamlessly generates in the background From independent designers and creative agencies to Fortune 500 companies millions worldwide use Webflow to be more nimble creative and collaborative Its the web made better <p> <p> We are looking for a Senior Backend Engineer to join the Shared Services team to enable our engineering team to build more efficiently so we can further our mission of bringing visual development superpowers to everyone If youre passionate about engineering excellence and driving operational efficiency wed love to hear from you <p> <h2> <strong> About the role <strong> <h2> <ul> <li> <p> Location Remotefirst United States BC amp ON Canada <p> <li> <li> <p> Fulltime <p> <li> <li> <p> Permanent <p> <li> <li> <p> Exempt <p> <li> <li> <p> The cash compensation for this role is tailored to align with the cost of labor in different geographic markets Weve structured the base pay ranges for this role into zones for our geographic markets and the specific base pay within the range will be determined by the candidates geographic location jobrelated experience knowledge qualifications and skills <p> <ul> <li> <p> United States all figures cited below in USD and pertain to workers in the United States <p> <ul> <li> <p> Zone A $162500 $216050 <p> <li> <li> <p> Zone B $152700 $203100 <p> <li> <li> <p> Zone C $14300 $190150 <p> <li> <ul> <li> <li> <p> Canada All figures cited below in CAD and pertain to workers in ON amp BC Canada <p> <ul> <li> <p> CAD 184600 CAD 245500 <p> <li> <ul> <li> <ul> <li> <li> <p> Please visit our <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowaboutwebflowiocareers rel=noopener noreferrer nofollow target=blank> Careers page <a> for more information on which locations are included in each of our geographic pay zones However please confirm the zone for your specific location with your recruiter <p> <li> <li> <p> Reporting to the engineering manager <p> <li> <ul> <p> As Senior Backend Engineer youll <p> <ul> <li> <p> Develop a comprehensive knowledge of how areas of business such as architecture and infrastructure integrate to improve developer productivity and accomplish our business goals <p> <li> <li> <p> Collaborate with software engineers product managers designers and QA analysts in an autonomous supportive team environment <p> <li> <li> <p> Build and maintain shared services including but not limited to Inapp Email Notification platform and Feature Flag framework <p> <li> <li> <p> Identify develop and document APIs for Webflows service catalog as well as provide quick start guides for developer best practices <p> <li> <li> <p> Solve problems in a highly technical platform that empowers hundreds of engineers <p> <li> <li> <p> Improve our planning development and deployment processes to help you and your fellow team members <p> <li> <li> <p> Mentor coach and inspire a team of engineers of various levels <p> <li> <ul> <p> In addition to the responsibilities outlined above at Webflow we will support you in identifying where your interests and development opportunities lie and well help you incorporate them into your role <p> <h2> <strong> About you <strong> <h2> <p> Youll thrive in this role if you <p> <ul> <li> <p> Have 5+ years developing and deploying web applications with a proven track record of shipping to market <p> <li> <li> <p> Excellent organization and communication skills both verbal and written <p> <li> <li> <p> Have worked on complex issues where the analysis requires an indepth knowledge of the company and existing architecture <p> <li> <li> <p> Can debug production issues across services and multiple levels of the stack <p> <li> <li> <p> Take pride in taking ownership and driving projects to business impact <p> <li> <li> <p> Proven experience building complex web systems <p> <li> <li> <p> Are familiar with one or more Javascript type systems we use TypeScript here <p> <li> <li> <p> Are comfortable working in an agile safetofail environment <p> <li> <ul> <p> <strong> Our Core Behaviors <strong> <p> <ul> <li> <p> <strong> Obsess over customer experience <strong> We deeply understand <em> what <em> were building and <em> who <em> were building for and serving We define the leading edge of whats possible in our industry and deliver the future for our customers <p> <li> <li> <p> <strong> Move with heartfelt urgency <strong> We have a healthy relationship with impatience channeling it thoughtfully to show up better and faster for our customers and for each other Time is the most limited thing we have and we make the most of every moment <p> <li> <li> <p> <strong> Say the hard thing with care <strong> Our best work often comes from intelligent debate critique and even difficult conversations We speak our minds and dont sugarcoat things and we do so with respect maturity and care <p> <li> <li> <p> <strong> Make your mark <strong> We seek out new and unique ways to create meaningful impact and we champion the same from our colleagues We work as a <em> team <em> to get the job done and we go out of our way to celebrate and reward those going above and beyond for our customers and our teammates <p> <li> <ul> <h3> <strong> Benefits amp wellness <strong> <h3> <ul> <li> <p> Equity ownership RSUs in a growing privatelyowned company <p> <li> <li> <p> 100 employerpaid healthcare vision and dental insurance coverage for employees and dependents fulltime employees working 30+ hours per week as well as Health Savings AccountHealth Reimbursement Account dependent care Flexible Spending Account US only dependent on insurance plan selection where applicable in the respective country of employment Employees may also have voluntary insurance options such as life disability hospital protection accident and critical illness where applicable in the respective country of employment <p> <li> <li> <p> 12 weeks of paid parental leave for both birthing and nonbirthing caregivers as well as an additional 68 weeks of pregnancy disability for birthing parents to be used before child bonding leave where local requirements are more generous employees receive the greater benefit Employees also have access to family planning care and reimbursement <p> <li> <li> <p> Flexible PTO with a mandatory annual minimum of 10 days paid time off for all locations where local requirements are more generous employees receive the greater benefit and sabbatical program <p> <li> <li> <p> Access to mental wellness and professional coaching therapy and Employee Assistance Program <p> <li> <li> <p> Monthly stipends to support health and wellness smart work and professional growth <p> <li> <li> <p> Professional career coaching internal learning amp development programs <p> <li> <li> <p> 401k plan and pension schemes in countries where statutorily required financial wellness benefits like CPA or financial advisor coverage <p> <li> <li> <p> Discounted Pet Insurance offering US only <p> <li> <li> <p> Commuter benefits for inoffice employees <p> <li> <ul> <h3> <strong> Be you with us <strong> <h3> <p> At Webflow equality is a core tenet of our culture We are an Equal Opportunity EEOVeteransDisabled Employer and are <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomdiversityequityinclusion rel=noopener noreferrer nofollow target=blank> committed <a> to building an inclusive global team that represents a variety of backgrounds perspectives beliefs and experiences Employment decisions are made on the basis of jobrelated criteria without regard to race color religion sex sexual orientation gender identity national origin disability veteran status or any other classification protected by applicable law Pursuant to the San Francisco Fair Chance Ordinance Webflow will consider for employment qualified applicants with arrest and conviction records <p> <h3> <strong> Stay connected <strong> <h3> <p> Not ready to apply but want to be part of the Webflow community Consider following our story on our <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomblog rel=noopener noreferrer nofollow target=blank> Webflow Blog <a> <a class=fontbold underline fontbold underline fontbold underline href=httpswwwlinkedincomcompanywebflowinc rel=noopener noreferrer nofollow target=blank> LinkedIn <a> <a class=fontbold underline fontbold underline fontbold underline href=httpstwittercomwebflow rel=noopener noreferrer nofollow target=blank> X Twitter <a> andor <a class=fontbold underline fontbold underline fontbold underline href=httpswwwglassdoorcomReviewsWebflowReviewsE890506htm rel=noopener noreferrer nofollow target=blank> Glassdoor <a> <p> <h3> <strong> Please note <strong> <h3> <p> <em> To join Webflow youll need valid US or Canadian work authorization depending on the country of employment <em> <p> <p> <em> If you are extended an offer that offer may be contingent upon your successful completion of a background check which will be conducted in accordance with applicable laws We may obtain one or more background screening reports about you solely for employment purposes <em> <p> <p> <em> For information about how Webflow processes your personal information please review <em> <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomlegalapplicantprivacynotice rel=noopener noreferrer nofollow target=blank> <em> Webflows Applicant Privacy Notice <em> <a> <em> <em> <p> <p> <p><p>
Senior Software Engineer - Cosmos Platform
Company: Bishop Fox
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> Bishop Fox is the leading authority in offensive security providing solutions ranging from continuous penetration testing red teaming and attack surface management to product cloud and application security assessments Weve worked with more than a quarter of the Fortune 100 half of the Fortune 10 eight of the top 10 global technology companies and all of the top global media companies Our Cosmos platform service innovation and culture of excellence continue to gather accolades from industry award programs including Fast Company Inc SC Media and others For more than 16 years weve been contributing and giving back to the security community Weve published more than 16 open source tools and 50 security advisories in the last five years alone Learn more at bishopfoxcom or follow us on social media <p> <p> Given our exceptional growth we are expanding and hiring a Software Engineer to join us on this exciting journey At Bishop Fox you will join a company of brilliant technologists to help build THE platform for offensive security Cosmos Working on Cosmos you will have the opportunity to build eventdriven domainoriented services across a wide spectrum of offensive security capabilities Each day will bring new challenges and problems to solve If you have strong experience with modern architecture cloud and languages such as Golang and Python are selfmotivated and enjoy solving problems at scale then the Cosmos Platform Engineering team is for you Bring your experience curiosity and will to deliver great technology and join our Cosmos Platform team <p> <h3> Responsibilities <h3> <p> As a member of the Cosmos Platform Engineering team you will design solutions write code and usher software into production You will build services that industrialize the automation of offensive security processes and provide security information to our customers in a scalable secure reliable cloud platform <p> <p> As a Senior Engineer you will take the lead on design solutions drive quality standards and provide technical leadership to the team and broader engineering organization <p> <h3> Requirements <h3> <ul> <li> <p> 5+ years of software development experience <p> <li> <li> <p> Professional experience with Golang or Python required <p> <li> <li> <p> Mastery in the foundations of Golang or Python and strong experience in building microservices in the specified language <p> <li> <li> <p> Experience in a professional software organization using an SDLC <p> <li> <li> <p> Understanding of coding best practices structure patterns unit tests secure coding etc <p> <li> <li> <p> Ability to work independently and also work together with the team to solve complex technical problems <p> <li> <ul> <h3> Preferred Skills and Experience <h3> <ul> <li> <p> Experience with Amazon Web Services AWS <p> <li> <li> <p> Eventdriven and asynchronous systems Rabbit SQS SNS Kafka Kinesis etc <p> <li> <li> <p> Experience using datastores SQL or NoSQL <p> <li> <li> <p> An interest in cybersecurity <p> <li> <ul> <p> Bishop Fox has always allowed its employees to work remotely and this role could work anywhere in the United States Our comprehensive benefits program is tailored to meet your needs at an affordable price We embrace diversity and an inclusive culture We value our employees and who they are which fosters a powerful and collective talent base to successfully serve our clients and the security community with unparalleled expertise <p> <p> <em> Bishop Fox is an Equal Opportunity employer All qualified applicants will receive consideration for employment without regard to race color religion sex including sexual orientation and gender identity national origin disability protected veteran status or any other characteristic protected by applicable federal state or local law All new hires must pass a background check as a condition of employment <em> <p> <p> Interested Apply today <p><p>
Director - Corporate FP&A
Company: Icertis
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> With unmatched technology and categorydefining innovation Icertis pushes the boundaries of whats possible with contract lifecycle management CLM The AIpowered analystvalidated Icertis Contract Intelligence ICI platform turns contracts from static documents into strategic advantage by structuring and connecting the critical contract information that defines how an organization runs Today the worlds most iconic brands and disruptive innovators trust Icertis to fully realize the intent of their combined 10 million contracts worth more than $1 trillion in 40+ languages and 93 countries <p> <p> <p> <p> <strong> Who we are <strong> Icertis is the only contract intelligence platform companies trust to keep them out in front now and in the future Our unwavering commitment to contract intelligence is grounded in our FORTE valuesFairness Openness Respect Teamwork and Executionwhich guide all our interactions with employees customers partners and stakeholders Because in our mission to be the contract intelligence platform of the world we believe how we get there is as important as the destination <p> <p> <p> <p> As the Director of FPampA you will play a critical leadership role you will work closely with all of companys functional leaders and bring key market strategic and operational insights that will shape the direction of the company and accelerate its growth You will also play a key role in telling the companys financial story to investors <p> <p> <p> <p> The ideal candidate will have a proven trackrecord of driving business outcomes through keen financial insight and business modeling They will have the ability to create a 360degree financial picture of the business that reflects and influences the companys strategy and be excellent at communicating with senior leaders and executives They will be toolsavvy with experience in creating scalable data and reporting solutions that support a datadriven culture LIRS1 <p> <p> <p> <p> <p> <p> <strong> What you will do <strong> <p> <ul> <li> <p> Formulate a robust 360degree financial picture of the business complete with market insights and operational drivers <p> <li> <li> <p> Develop and maintain the 3year Strategic Planning Model and forecast <p> <li> <li> <p> Deliver Global PampL and cash flow forecasts <p> <li> <li> <p> Drive Annual Planning Process work cross functionally to build and maintain the Annual Financial Plan and Departmental Budgets <p> <li> <li> <p> Build and deliver Business Performance ReportingOperating dashboards <p> <li> <li> <p> Perform strategic business analysis as needed MampA Geo Expansion <p> <li> <li> <p> Prepare financial analyses as needed to help drive improvements in the business Current focus areas include market expansion opportunities competitive benchmarking analyses pricing and strategic financial optimization strategies <p> <li> <li> <p> Partner with Controller to enhance and accelerate the financial reporting process <p> <li> <li> <p> Identifies and implements system and process improvements to increase the efficiency and effectiveness of planning and reporting workflows <p> <li> <li> <p> Prepare communications to Board of Directors <p> <li> <li> <p> Drive investor presentations and supporting analysis <p> <li> <li> <p> Develop a deep understanding of the business metrics with an eye towards understanding the benefits and risks from a financial perspective and helping to manage key business drivers and desired outcomes <p> <li> <li> <p> Play a key role in preparation of critical public financial documents to support the IPO process including working with bankers and supporting the production of investor materials and SEC filings eg S1 <p> <li> <ul> <p> <p> <p> <strong> What you will bring <strong> <p> <ul> <li> <p> 12+ years of experience of working in direct strategic analysis support of all aspects of the business at all areas of the PampL <p> <li> <li> <p> MBACPA or equivalent experience preferred <p> <li> <li> <p> Demonstrated complex modeling experience this is a handson role and managers are expected to directly contribute and lead by example <p> <li> <li> <p> Highly analytical detailoriented with a commitment to creating a highquality product Naturally inquisitive and able to extract information from various sources to identify and understand the underlying issue Not afraid to question results <p> <li> <li> <p> Prior success working in a fastpaced entrepreneurial environment takes initiative and works independently <p> <li> <li> <p> Working knowledge of accounting principles required including revenue recognition amortization and accrual vs cash accounting Must have a general understanding of financial statements <p> <li> <li> <p> Must have exceptional written visual and spoken communication skills <p> <li> <li> <p> Experience in preparing and delivering executive board and investor level communications <p> <li> <li> <p> IPO experience is a plus <p> <li> <li> <p> Must have advanced Excel Netsuite and Powerpoint skills <p> <li> <li> <p> Experience implementing financial analysis and planning tools required <p> <li> <ul> <p> <p> <p> <p> <p> $146000 $219000 a year <p> <p> <em> Pay offered will vary based on jobrelated factors such as location experience training skills and abilities In addition to the base salary and annual bonus target and an equity component is included in the compensation package <em> <p> <p> <strong> What we offer <strong> <p> <p> We are committed to the health and wellbeing of all Icertians their families the communities they live in and our customers This commitment is represented in the Icertis Four Rings of Responsibility Take Care of Self Take Care of Family Take Care of Community and Take Care of Business in that order <p> <p> <p> <p> To support these commitments Icertis offers excellent health and welfare benefits a generous 401k match and a robust paid time off program Here are some of the other reasons <a class=fontbold underline fontbold underline postingslink href=httpswwwicertiscomcompanynewsicertisplacesfirstinwashingtons100bestcompaniestoworkfor rel=noopener noreferrer nofollow target=blank> Icertis Places First in Washingtons 100 Best Companies to Work For | Icertis <a> <p> <p> <p> <p> ● Equity RSUs and shared ownership in the company <p> <p> ● Flexible work environment <p> <p> ● Paid maternity and paternity leave <p> <p> ● 7 Days for Humanity 7 paid volunteer days <p> <p> ● Generous holidays including the 4th of July week off paid <p> <p> ● Free professional and leadership coaching <p> <p> ● Annual personal development allowance <p> <p> <p> <p> Icertis Inc provides Equal Employment Opportunity to all employees and applicants for employment without regard to race color religion gender identity or expression sex sexual orientation national origin age disability genetic information marital status amnesty or status as a covered veteran in accordance with applicable federal state and local laws Icertis Inc complies with applicable state and local laws governing nondiscrimination in employment in every location in which the company has facilities If you are in need of accommodation or special assistance to navigate our website or to complete your application please send an email with your request to <a class=fontbold underline fontbold underline postingslink href=mailtocareersicertiscom rel=noopener noreferrer nofollow target=blank> careersicertiscom <a> or get in touch with your recruiter <p> <p> <p> <p> By submitting your application you acknowledge that you have read Icertiss Privacy Policy <a class=fontbold underline fontbold underline postingslink href=httpswwwicertiscomprivacystatement rel=noopener noreferrer nofollow target=blank> httpswwwicertiscomprivacystatement <a> <p> <p> <p> <p> Icertis is not open to third party solicitation or resumes for our posted FTE positions Resumes received from third party agencies that are unsolicited will be considered complimentary <p><p>
Brand Designer
Company: Modern Health
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <h2> The Role <h2> <p> Are you an ambitious creative professional Does joining a rapidlygrowing tech company in the health and mental wellbeing space sound exciting The Marketing team at Modern Health is hiring a Brand Designer to help build our brand identity as we expand executing a wide range of projects including web content email newsletters videos advertising conference materials sales presentations onesheeters and much more You will be a key member of the Marketing team collaborating across product customer success clinical care and recruiting to build a cohesive elevated brand for Modern Health and to ensure specific messages are being visually conveyed through your designs <p> <p> This position is not eligible to be performed in Hawaii <p> <h2> <strong> What Youll Do <strong> <h2> <ul> <li> <p> Manage project request intake and scope clarification <p> <li> <li> <p> Design and development of marketing materials including website pages presentations print and digital advertising conference materials research reports social media campaigns onesheeters postcards promotions videos webinars and other marketing collateral <p> <li> <li> <p> Collaborate with other marketing and product team members to ensure quality and consistency in all aspects of our brand presence <p> <li> <li> <p> Provide status updates and juggle multiple projectswere an agile team with shifting priorities <p> <li> <li> <p> Become an informed and vocal advocate of great design at Modern Health <p> <li> <ul> <h2> <strong> Who You Are <strong> <h2> <ul> <li> <p> 3+ years of design experience in a fastpaced highgrowth environment <p> <li> <li> <p> MUST have an online portfolio of relevant work examples <p> <li> <li> <p> Handson experience with Figma Adobe Creative Suite including Photoshop and llustrator <p> <li> <li> <p> Use of MS Office and Google Docs and how those are used crossfunctionally with Adobe CS <p> <li> <li> <p> Experience working with web developer to develop website pages <p> <li> <li> <p> Knowledge of how to prepare files for optimal online use and print bleed areas CMYK Pantone RGB etc <p> <li> <li> <p> Understand the different pixel resolutions required for print and online <p> <li> <li> <p> Experience working within existing brand guidelines andor designing new brand guidelines <p> <li> <li> <p> Must be highly detail oriented and selfmotivated and able to prioritize your workload to meet critical deadlines <p> <li> <li> <p> Able to work well independently as well as under the direction of others <p> <li> <li> <p> Coachable and values constructive criticism from a variety of sources <p> <li> <li> <p> Excellent written and verbal communication skills <p> <li> <li> <p> Curious creative flexible proactive and ambitious <p> <li> <ul> <h2> <strong> Benefits <strong> <h2> <p> Fundamentals <p> <ul> <li> <p> Medical Dental Vision Disability Life Insurance <p> <li> <li> <p> High Deductible Health Plan with Health Savings Account HSA option <p> <li> <li> <p> Flexible Spending Account FSA <p> <li> <li> <p> Access to coaches and therapists through Modern Healths platform <p> <li> <li> <p> Generous Time Off <p> <li> <li> <p> Companywide Collective Pause Days <p> <li> <ul> <p> Family Support <p> <ul> <li> <p> Parental Leave Policy <p> <li> <li> <p> Family Forming Benefit through Carrot <p> <li> <li> <p> Family Assistance Benefit through UrbanSitter <p> <li> <ul> <p> Professional Development <p> <ul> <li> <p> Professional Development Stipend <p> <li> <ul> <p> Financial Wellness <p> <ul> <li> <p> 401k <p> <li> <li> <p> Financial Planning Benefit through Origin <p> <li> <ul> <p> But wait theres more <p> <ul> <li> <p> Annual Wellness Stipend to use on items that promote your overall well being <p> <li> <li> <p> New Hire Stipend to help cover workfromhome setup costs <p> <li> <li> <p> ModSquad Community Virtual events like active ERGs holiday themed activities teambuilding events and more <p> <li> <li> <p> Monthly Cell Phone Reimbursement <p> <li> <ul><p>
Machine Learning Engineer (L3)
Company: Twilio
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <h3> <strong> See yourself at Twilio <strong> <h3> <p> Join the team as Twilios next Machine Learning Engineer L3 on the Data Services and Throughput team <p> <h3> <strong> Who we are amp why were hiring <strong> <h3> <p> Twilio powers realtime business communications and data solutions that help <a class=fontbold underline fontbold underline fontbold underline href=httpscustomerstwiliocom rel=noopener noreferrer nofollow target=blank> companies and developers worldwide <a> build better applications and customer experiences <p> <p> Although were headquartered in San Francisco we have presence throughout South America Europe Asia and Australia Were on a journey to becoming a global company that actively opposes racism and all forms of oppression and bias At Twilio we support <a class=fontbold underline fontbold underline fontbold underline href=httpswwwtwiliocomcompanydiversity rel=noopener noreferrer nofollow target=blank> diversity equity amp inclusion <a> wherever we do business <p> <h3> <strong> About the job <strong> <h3> <p> This position is needed to to drive the innovation and creation of cuttingedge products that serve the needs of developers builders and operators You will be a crucial bridge between Product and Design tasked with developing evaluating and maintaining scalable Machine Learning models within lowlatency for realtime applications Your collaboration and expertise will be fundamental in delivering robust solutions that power our users success You will be closely working with a crossfunctional team of engineers architects product UIUX and partners to develop ML and data driven algorithm aspects of customer facing products in Twilio Communication applications <p> <p> Twilio Communications is the leading software for sending messages programmatically The Data Services and Throughput organization builds AIenabled capabilities that separate Twilio from its competitors in messaging capabilities <p> <h3> <strong> Responsibilities <strong> <h3> <p> In this role youll <p> <ul> <li> <p> Build and maintain scalable high quality machine learning solutions in production <p> <li> <li> <p> Design and implement tools and procedures to evaluate performance and accuracy of models and data <p> <li> <li> <p> Work closely with software engineers build tools to enhance productivity and to ship and maintain ML models <p> <li> <li> <p> Demonstrate endtoend understanding of applications and why behind models amp systems and develop high quality MLbased software at scale <p> <li> <li> <p> Truly own the product you work on Be responsible for SLA on call incident resolution customer feedback and participate in blameless postmortems to make our products better <p> <li> <li> <p> Partner with product managers tech leads and stakeholders to analyze business problems clarify requirements and define the scope of the systems and leverage stateoftheart Statistics Machine Learning Deep Learning and Gen AI to address the business problems <p> <li> <li> <p> Drive high engineering standards on the team through code review automated testing and mentoring <p> <li> <li> <p> Collaborate and brainstorm product ideas with product managers designers and engineers <p> <li> <ul> <h3> <strong> Qualifications <strong> <h3> <p> Not all applicants will have skills that match a job description exactly Twilio values diverse experiences in other industries and we encourage everyone who meets the required qualifications to apply While having desired qualifications make for a strong candidate we encourage applicants with alternative experiences to also apply If your career is just starting or hasnt followed a traditional path dont let that stop you from considering Twilio We are always looking for people who will bring something new to the table <p> <p> <strong> Required <strong> <p> <ul> <li> <p> 4+ years of applied ML experience <p> <li> <li> <p> Strong background in the foundations of machine learning and building blocks of modern deep learning <p> <li> <li> <p> Proficiency in Python or Java and familiarity with design patterns <p> <li> <li> <p> Track record of building shipping and maintaining machine learning models in production <p> <li> <li> <p> Extensive experience in technologies such as PyTorch Tensorflow Scikitlearn Spacy NLTK application frameworks eg Flask <p> <li> <li> <p> Deep understanding of ML model implementation cycle eg feature engineering trainingserving AB test model selection etc algorithms eg xgboost time series models deep learning graph neural networks optimization and domains eg forecasting personalization and recommendation system NLP embedding representation <p> <li> <li> <p> Familiarity with MLOps concepts related and maintaining models in production such as testing versioning model registry retraining and monitoring <p> <li> <li> <p> Demonstrated ability to ramp up understand and operate effectively in new application business domains <p> <li> <li> <p> Good written and verbal communication skills You are confident in writing down and presenting your designs and decisions throughout the development lifecycle You are also comfortable providing and receiving feedback in an Agile environment <p> <li> <ul> <p> <strong> Desired <strong> <p> <ul> <li> <p> Experience in recommendation systems forecasting models NLP techniques embedding representation approaches and statistical models <p> <li> <li> <p> Experience with Retrieval Augmented Generation Large Language Models and prompt engineering <p> <li> <li> <p> Knowledge of Java and system design concepts <p> <li> <li> <p> Understanding of Experience with CICD pipelines and automated deployment processes <p> <li> <li> <p> Experience with either AWS Azure or Google Cloud and technologies such as Spark Kafka Kubeflow GPU <p> <li> <ul> <h3> <strong> Location <strong> <h3> <p> This role will be and based in the US but is not eligible to be hired in NY WA CT CA and PA <p> <h3> <strong> Travel <strong> <h3> <p> We prioritize connection and opportunities to build relationships with our customers and each other For this role you may be required to travel occasionally to participate in project or team inperson meetings <p> <h3> <strong> What We Offer <strong> <h3> <p> There are many benefits to working at Twilio including in addition to competitive pay things like generous timeoff ample parental and wellness leave healthcare a retirement savings program and much more Offerings vary by location <p> <h3> <strong> Twilio thinks big Do you <strong> <h3> <p> We like to solve problems take initiative pitch in when needed and are always up for trying new things Thats why we seek out colleagues who embody our values something we call <a class=fontbold underline fontbold underline fontbold underline href=httpswwwtwiliocomcompanyvalues rel=noopener noreferrer nofollow target=blank> Twilio Magic <a> Additionally we empower employees to build <a class=fontbold underline fontbold underline fontbold underline href=httpstwilioorgsupportandresourcesimpactfund rel=noopener noreferrer nofollow target=blank> positive change in their communities <a> by supporting their volunteering and donation efforts <p> <p> So if youre ready to unleash your full potential do your best work and be the best version of yourself apply now <p> <p> If this role isnt what youre looking for <a class=fontbold underline fontbold underline fontbold underline href=httpswwwtwiliocomcompanyjobsopenpositions rel=noopener noreferrer nofollow target=blank> please consider other open positions <a> <p> <p> <em> Please note this role is open to candidates outside of Colorado California New York and Washington The information below is provided for candidates hired in those locations only <em> <p> <p> The estimated pay ranges for this role are as follows <p> <ul> <li> <p> Based in Colorado $13500 $169000 <p> <li> <li> <p> This role may be eligible to participate in Twilios equity plan and corporate bonus plan All roles are eligible for the following benefits health care insurance 401k retirement account paid sick time paid personal time off paid parental leave <p> <li> <ul> <p> The successful candidates starting salary will be determined based on permissible nondiscriminatory factors such as skills experience and geographic location within the state <p> <p> <strong> Twilio is proud to be an equal opportunity employer <strong> Twilio is proud to be an Equal Employment Opportunity and Affirmative Action employer We do not discriminate based upon race religion color national origin sex including pregnancy childbirth reproductive health decisions or related medical conditions sexual orientation gender identity gender expression age status as a protected veteran status as an individual with a disability genetic information political views or activity or other applicable legally protected characteristics We also consider qualified applicants with criminal histories consistent with applicable federal state and local law Additionally Twilio participates in the EVerify program in certain locations as required by law <p> <p> Twilio is committed to providing reasonable accommodations for qualified individuals with disabilities and disabled veterans in our job application procedures If you need assistance or an accommodation due to a disability please contact us at accommodationtwiliocom <p><p>
Software Engineer - Seller Experience
Company: Whatnot
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <h2> <strong> 🚀 Whatnot <strong> <h2> <p> Whatnot is a livestream shopping platform and marketplace backed by Andreessen Horowitz Y Combinator and CapitalG Were building the future of ecommerce bringing together community shopping and entertainment We are committed to our <a class=fontbold underline fontbold underline fontbold underline href=httpswwwwhatnotcomcareers rel=noopener noreferrer nofollow target=blank> values <a> and as a remotefirst team we operate out of hubs within the US Canada UK Ireland and Germany today <p> <p> Were innovating in the fastpaced world of live auctions in categories including sports fashion video games and streetwear The platform couples rigorous seller vetting with a focus on community to create a welcoming space for buyers and sellers to share their passions with others <p> <p> And were growing Whatnot has been the <a class=fontbold underline fontbold underline fontbold underline href=httpsa16zcommarketplace100 rel=noopener noreferrer nofollow target=blank> fastest growing marketplace <a> in the US over the past two years and were hiring forwardthinking problem solvers across all functional areas <p> <h2> <strong> 💻 Role <strong> <h2> <p> The Seller Experience team plays a crucial role in empowering our community of sellers with tools and experiences that allow them to succeed and grow on Whatnot You will be at the forefront of developing scalable user friendly solutions that enhance the seller journey at every step of the lifecycle from onboarding scaling and growth The problems you will tackle span from Casual Resellers to Large Retailers <p> <h2> <strong> 👋 You <strong> <h2> <p> Curious about who thrives at Whatnot Weve found that low ego a growth mindset and leaning into action and high impact goes a long way here <p> <p> As our next Software Engineer you should have 5+ years of generalist software engineering experience at a fast growing technology company plus <p> <ul> <li> <p> We primarily use Python JavaScript Elixir and are open to others <p> <li> <li> <p> Excellent product instincts You first think about users rather than the best technical solution <p> <li> <li> <p> You are known for shipping products and features lightningfast <p> <li> <li> <p> Youre an excellent problem solver and dont need to be told exactly what to do <p> <li> <li> <p> Comfortable working across the stack backend and frontend <p> <li> <li> <p> Ability to pick up on new technologies very quickly <p> <li> <li> <p> Proven track record of delivering features <p> <li> <li> <p> Bonus Experience building technology in ecommerce contributing to seller experiences and success <p> <li> <ul> <h2> <strong> 💰Compensation <strong> <h2> <p> For USbased applicants <strong> <strong> $178000year to $235000year + benefits + stock options <p> <p> The salary range may be inclusive of several levels that would be applicable to the position Final salary will be based on a number of factors including level relevant prior experience skills and expertise This range is only inclusive of base salary not benefits more details below or equity in the form of stock options <p> <h2> <strong> 🎁 Benefits <strong> <h2> <ul> <li> <p> Flexible Time off Policy and Companywide Holidays including a spring and winter break <p> <li> <li> <p> Health Insurance options including Medical Dental Vision <p> <li> <li> <p> Work From Home Support <p> <ul> <li> <p> $1000 home office setup allowance <p> <li> <li> <p> $150 monthly allowance for cell phone and internet <p> <li> <ul> <li> <li> <p> Care benefits <p> <ul> <li> <p> $450 monthly allowance on food <p> <li> <li> <p> $500 monthly allowance for wellness <p> <li> <li> <p> $5000 annual allowance towards Childcare <p> <li> <li> <p> $20000 lifetime benefit for family planning such as adoption or fertility expenses <p> <li> <ul> <li> <li> <p> Retirement 401k offering for Traditional and Roth accounts in the US employer match up to 4 of base salary and Pension plans internationally <p> <li> <li> <p> Parental Leave <p> <ul> <li> <p> 16 weeks of paid parental leave + one month gradual return to work company leave allowances run concurrently with country leave requirements which take precedence <p> <li> <ul> <li> <ul> <h2> <strong> 💛 EOE <strong> <h2> <p> Whatnot is proud to be an Equal Opportunity Employer We value diversity and we do not discriminate on the basis of race religion color national origin gender sexual orientation age marital status veteran status parental status disability status or any other status protected by local law We believe that our work is better and our company culture is improved when we encourage support and respect the different skills and experiences represented within our workforce <p><p>
Backend Engineer
Company: Trufflesecurity
Location: USA
Posted Apr 30, 2024
Truffle Security Co is seeking a passionate Software Engineer with experience in Go, gRPC, and K8s to contribute to their core product features. The role involves backend development, gRPC clients and servers, and continuous learning. The company offers a competitive compensation package, flexible paid time off, and a commitment to building a culture of mentorship, equity, and psychological safety. They are looking for individuals who are passionate about open source, security, and building an enjoyable UX.
Senior Backend Engineer - Styles
Company: Webflow
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> At Webflow our mission is to bring development superpowers to everyone Webflow is the leading visual development platform for building powerful websites without writing code By combining modern web development technologies into one platform Webflow enables people to build websites visually saving engineering time while clean code seamlessly generates in the background From independent designers and creative agencies to Fortune 500 companies millions worldwide use Webflow to be more nimble creative and collaborative Its the web made better <p> <p> The Styles team is responsible for building and investing in the design capabilities of our core product to empower millions of designers worldwide to easily adopt Webflow to build manage and scale any number of sites efficiently <p> <p> Were looking for a Senior Backend Engineer to join the Styles team and lead the team to deliver impactful features for our customers to build highly personalized web experiences In this role you will execute the technical direction and be a mentor amp partner to other engineers on the team Additionally you will help lead crossfunctional efforts to drive even greater impact <p> <h2> <strong> About the role <strong> <h2> <ul> <li> <p> Location Remotefirst United States BC amp ON Canada <p> <li> <li> <p> Fulltime <p> <li> <li> <p> Permanent <p> <li> <li> <p> Exempt US Candidates <p> <li> <li> <p> Reporting to the Engineering Manager of Designer UX team <p> <li> <li> <p> The cash compensation for this role is tailored to align with the cost of labor in different geographic markets Weve structured the base pay ranges for this role into zones for our geographic markets and the specific base pay within the range will be determined by the candidates geographic location jobrelated experience knowledge qualifications and skills <p> <ul> <li> <p> Zone A $162500 $216050 <p> <li> <li> <p> Zone B $152700 $203100 <p> <li> <li> <p> Zone C $143000 $190150 <p> <li> <ul> <ul> <li> <p> CAD 184600 CAD 245500 <p> <li> <ul> <ul> <li> <p> United States all figures cited below in USD and pertain to workers in the United States <p> <li> <li> <p> Canada All figures cited below in CAD and pertain to workers in ON amp BC Canada <p> <li> <ul> <li> <ul> <p> Please visit our <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowaboutwebflowiocareers rel=noopener noreferrer nofollow target=blank> Careers page <a> for more information on which locations are included in each of our geographic pay zones However please confirm the zone for your specific location with your recruiter <p> <p> As a Senior Backend Engineer youll <p> <ul> <li> <p> Design and implement scalable backend services <p> <li> <li> <p> Drive crosspillar collaboration with software engineers product managers designers and QA analysts in an autonomous supportive team environment <p> <li> <li> <p> Effectively communicate team priorities and strategy to engineering and crossfunctional leadership teams <p> <li> <li> <p> Build and maintain unit and integration tests <p> <li> <li> <p> Provide clarity on processes and priorities to crosspillar partners and other engineers on the team <p> <li> <li> <p> Mentor other engineers on best practices code design considerations and quality <p> <li> <ul> <p> In addition to the responsibilities outlined above at Webflow we will support you in identifying where your interests and development opportunities lie and well help you incorporate them into your role <p> <h2> <strong> About you <strong> <h2> <p> Youll thrive as a Senior Backend Engineer Styles if you <p> <ul> <li> <p> Have 5+ years of experience in scalable multitenant environments <p> <li> <li> <p> Have 2+ years experience working with feature teams on customerfacing products shipping and iterating to solve customer problems <p> <li> <li> <p> Value testing and documentation equally as much as your code <p> <li> <li> <p> Are comfortable with ambiguity and scoping solutions with your teammates <p> <li> <li> <p> Are comfortable working on JavascriptTypescript MongoDB and Node <p> <li> <li> <p> Have consistently communicated trade offs throughout a project to meet both technical and business requirements <p> <li> <li> <p> Enjoy highvisibility work and presenting to executive counterparts <p> <li> <li> <p> Get excited about encouraging and developing other engineers <p> <li> <ul> <p> Even if you dont meet 100 of the above qualifications you should still seriously consider applying Research shows that you may still be considered for a role if you meet just half of the requirements <p> <p> <strong> Our Core Behaviors <strong> <p> <ul> <li> <p> <strong> Obsess over customer experience <strong> We deeply understand what were building and who were building for and serving We define the leading edge of whats possible in our industry and deliver the future for our customers <p> <li> <li> <p> <strong> Move with heartfelt urgency <strong> We have a healthy relationship with impatience channeling it thoughtfully to show up better and faster for our customers and for each other Time is the most limited thing we have and we make the most of every moment <p> <li> <li> <p> <strong> Say the hard thing with care <strong> Our best work often comes from intelligent debate critique and even difficult conversations We speak our minds and dont sugarcoat things and we do so with respect maturity and care <p> <li> <li> <p> <strong> Make your mark <strong> We seek out new and unique ways to create meaningful impact and we champion the same from our colleagues We work as a team to get the job done and we go out of our way to celebrate and reward those going above and beyond for our customers and our teammates <p> <li> <ul> <h3> <strong> Benefits amp wellness <strong> <h3> <ul> <li> <p> Equity ownership RSUs in a growing privatelyowned company <p> <li> <li> <p> 100 employerpaid healthcare vision and dental insurance coverage for employees and dependents fulltime employees working 30+ hours per week as well as Health Savings AccountHealth Reimbursement Account dependent care Flexible Spending Account US only dependent on insurance plan selection where applicable in the respective country of employment Employees may also have voluntary insurance options such as life disability hospital protection accident and critical illness where applicable in the respective country of employment <p> <li> <li> <p> 12 weeks of paid parental leave for both birthing and nonbirthing caregivers as well as an additional 68 weeks of pregnancy disability for birthing parents to be used before child bonding leave where local requirements are more generous employees receive the greater benefit Employees also have access to family planning care and reimbursement <p> <li> <li> <p> Flexible PTO with a mandatory annual minimum of 10 days paid time off for all locations where local requirements are more generous employees receive the greater benefit and sabbatical program <p> <li> <li> <p> Access to mental wellness and professional coaching therapy and Employee Assistance Program <p> <li> <li> <p> Monthly stipends to support health and wellness smart work and professional growth <p> <li> <li> <p> Professional career coaching internal learning amp development programs <p> <li> <li> <p> 401k plan and pension schemes in countries where statutorily required financial wellness benefits like CPA or financial advisor coverage <p> <li> <li> <p> Discounted Pet Insurance offering US only <p> <li> <li> <p> Commuter benefits for inoffice employees <p> <li> <ul> <p> <em> Temporary employees are not eligible for paid holiday time off accrued paid time off paid leaves of absence or companysponsored perks unless otherwise required by law <em> <p> <h3> <strong> Be you with us <strong> <h3> <p> At Webflow equality is a core tenet of our culture We are an Equal Opportunity EEOVeteransDisabled Employer and are <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomdiversityequityinclusion rel=noopener noreferrer nofollow target=blank> committed <a> to building an inclusive global team that represents a variety of backgrounds perspectives beliefs and experiences Employment decisions are made on the basis of jobrelated criteria without regard to race color religion sex sexual orientation gender identity national origin disability veteran status or any other classification protected by applicable law Pursuant to the San Francisco Fair Chance Ordinance Webflow will consider for employment qualified applicants with arrest and conviction records <p> <h3> <strong> Stay connected <strong> <h3> <p> Not ready to apply but want to be part of the Webflow community Consider following our story on our <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomblog rel=noopener noreferrer nofollow target=blank> Webflow Blog <a> <a class=fontbold underline fontbold underline fontbold underline href=httpswwwlinkedincomcompanywebflowinc rel=noopener noreferrer nofollow target=blank> LinkedIn <a> <a class=fontbold underline fontbold underline fontbold underline href=httpstwittercomwebflow rel=noopener noreferrer nofollow target=blank> X Twitter <a> andor <a class=fontbold underline fontbold underline fontbold underline href=httpswwwglassdoorcomReviewsWebflowReviewsE890506htm rel=noopener noreferrer nofollow target=blank> Glassdoor <a> <p> <h3> <strong> Please note <strong> <h3> <p> <em> We will ensure that individuals with disabilities are provided reasonable accommodation to participate in the job application or interview process to perform essential job functions and to receive other benefits and privileges of employment Upon interview scheduling instructions for confidential accommodation requests will be administered <em> <p> <p> <em> To join Webflow youll need a valid right to work authorization depending on the country of employment <em> <p> <p> <em> If you are extended an offer that offer may be contingent upon your successful completion of a background check which will be conducted in accordance with applicable laws We may obtain one or more background screening reports about you solely for employment purposes <em> <p> <p> <em> For information about how Webflow processes your personal information please review <em> <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomlegalapplicantprivacynotice rel=noopener noreferrer nofollow target=blank> <em> Webflows Applicant Privacy Notice <em> <a> <em> <em> <p><p>
Principal Engineer
Company: TeamSnap
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> <strong> 🌎 About Us <strong> <p> <p> At TeamSnap we believe when the world connects through sports the world becomes better TeamSnap is a sports and communication platform dedicated to taking the work out of play in youth sports We also believe our jobs should excite us our teammates should support us and our bosses should inspire us We empower our people to bring big ideas and tiny egos landing us on Outside Magazines list of <strong> Best Places to Work <strong> and Built Ins <strong> 100 Best RemoteFirst Places to Work <strong> <p> <p> <p> <p> TeamSnap is seeking a Principal Engineer who will report directly to the VP Engineering and Chief Architect to help define lead and drive our technological evolution As a technology leader youll shape our engineering culture in a positive direction with transparency and collaboration by mentoring leading and pairing with teams to evolve their practices and technical vision <p> <p> <p> <p> <p> <p> <strong> What youll be doing <strong> <p> <ul> <li> <p> Execute on the establishment of reference architecture and domain models <p> <li> <li> <p> Influence evolution of developer tooling and experience <p> <li> <li> <p> Help drive the definition of emerging technical and architectural strategies <p> <li> <li> <p> Supporting execution of critical projects via joining scrum teams as an additive team member ensuring the continuity of deliverables beyond scrum team interaction <p> <li> <li> <p> Ensure strong documentation of all systementerprise architecture as well as ancillary collateral such as sequence diagrams eventing orchestration layers and interoperability <p> <li> <li> <p> Define and own core KPIs to track the maintainability and effectiveness of our architecture and technology <p> <li> <li> <p> Encourage innovation creative thought and new ideassolutions <p> <li> <li> <p> Work with department leaders to identify shape and capture strategic technical work <p> <li> <li> <p> Being a strong partner and goto person for all engineering teams <p> <li> <li> <p> Contributing to engineeringwide goals priorities and improvements <p> <li> <li> <p> Consistently and systemically rallying inspiring and empowering all teams to do their best work ever <p> <li> <ul> <p> <p> <p> <strong> Whatll set you up for success <strong> <p> <ul> <li> <p> Experience leading and driving engineering departmentwide change during an evolutionary period of rapid growth and change while serving as a role model for an inclusive engineering culture <p> <li> <li> <p> Experience supporting both product and platform engineering teams as well as familiarity with our tech stack Google Cloud Platform Kubernetes Docker Terraform Datadog Elixir Typescript Golang <p> <li> <li> <p> Experience working across crossfunctional teams to foster a culture of priority setting and urgency in alignment with organizational strategy <p> <li> <li> <p> Deep experience in at least one of the following frontend web architecture mobile development platforms serverless and serverfull hybrid cloud architectures industryleading developer experience automation and tooling <p> <li> <li> <p> Youre comfortable working with nontechnical senior leaders and can convey complex technical topics to them in an approachable manner inviting collaborative discussion while also sweating and diving into the details whenever necessary getting your hands dirty and diving into code with any engineers across our department <p> <li> <li> <p> Ideally you have strong experience at Codenames we play every two weeks <p> <li> <ul> <p> <p> <p> <p> <p> Got cold feet If youre thinking you dont meet 100 of the above qualifications <strong> you should still seriously consider applying <strong> Were all humans with special talents that go beyond whats listed here <p> <p> <p> <p> <strong> Compensation <strong> <p> <p> Were committed to equitable compensation for all TeamSnappers The salary for this role starts at a minimum of $170000 inclusive of bonus and benefits Compensation is adjusted based on work experience skills certifications and geographic location Comp is highly competitive nationwide so please dont hesitate to apply <p> <p> <p> <p> <strong> 🖥 Location <strong> <p> <p> TeamSnap is a fully remote company so you need to be very comfortable working with people who arent in the same time zone as you We are always expanding but there is a small list of states we do not hire in including Alabama Alaska Delaware District of Columbia Hawaii Iowa Louisiana Mississippi Nebraska New Mexico Rhode Island South Dakota and West Virginia and while we love all parts of the world we can only hire permanent US residents at this time <p> <p> <p> <p> <strong> 🚀 Opportunities to Grow <strong> <p> <p> At TeamSnap we work hard to provide a culture of trust accountability inclusivity and boundless opportunities to grow along with the chance to make a lasting impact and have some fun while doing it <p> <p> <p> <p> <strong> 🎩 Total Rewards <strong> <p> <p> Were proud to be <a class=fontbold underline fontbold underline postingslink href=httpswwwinccommattgiventhisstartupceospolicyonworkingremotelyisgeniusanditsbasedonafamoustvshowhtml rel=noopener noreferrer nofollow target=blank> <strong> remotefirst <strong> <a> <strong> <strong> Weve been remote since 2009 long before COVID made it cool <p> <p> Unlimited PTO and paid parental leave for ALL parents not just primary or secondary <p> <p> 100 premium coverage of medicaldentalvision for you and your family <p> <p> 401K to help you invest for the future <p> <p> $1500 annual learning and development stipend <p> <p> Travel to fun locations for allcompany meetings and team events <p> <p> Generous home office allowance to set you up for success <p> <p> TeamSnap SWAG to our <a class=fontbold underline fontbold underline postingslink href=httpsteamlockersquadlockercomlockersteamsnap401580 rel=noopener noreferrer nofollow target=blank> store <a> upon starting and a $50 credit on every work anniversary thereafter <p> <p> A monthly stipend reimbursement for health amp wellness and so much more <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpsdocsgooglecompresentationd1oER8pxhc3zkKRDigScyXd6nQWVNFPV6HwATawDsGhukeditslide=idg22b26eb773f1392 rel=noopener noreferrer nofollow target=blank> TeamSnap Total Rewards <a> <p> <p> <p> <p> 🏆 <strong> Working at TeamSnap <strong> <p> <p> At TeamSnap youre not a culture fit youre a culture add Check out our <a class=fontbold underline fontbold underline postingslink href=httpswwwcanvacomdesignDAE4bjYNX4xtJEKWBDcTWpSARgrKMAoAviewutmcontent=DAE4bjYNX4amputmcampaign=designshareamputmmedium=linkamputmsource=publishsharelink1 rel=noopener noreferrer nofollow target=blank> <strong> Culture Playbook <strong> <a> and learn how we succeed at being remotefirst what makes our company so unique and how were inspired by our people our customers and our values <p> <p> <p> <p> <strong> 🧡 Inclusion and Diversity <strong> <p> <p> Creativity and innovation cant thrive when were cookiecutter images of each other Were quickly growing more diverse but theres always room for improvement We are committed to inclusion and diversity at TeamSnap and we hold ourselves accountable for building an environment where everyone feels valued If you need any disabilityrelated adaptation during the recruitment process just let us know We are an Equal Employment Opportunity Employer <p><p>
Account Executive (Manager/Director of Strategic Accounts)
Company: OfferFit
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> <strong> Position Overview <strong> <p> <p> Were currently looking for a driven Account Executive ManagerDirector of Strategic Accounts to join our team In this role youll be responsible for winning and growing business for OfferFit by owning new and existing senior customer relationships <p> <p> <strong> In particular you will <strong> <p> <ul> <li> <p> Working closely with our business development amp marketing teams to create leads <p> <li> <li> <p> Lead discussions with potential new OfferFit customers <p> <li> <li> <p> Work with current and future OfferFit customers to determine the highestimpact applications of our AIsolution <p> <li> <li> <p> Participate in OfferFit POV motion to ensure they progress successfully working closely with OfferFits technical Implementation team <p> <li> <li> <p> Build amp own relationships with senior leaders at OfferFits customer companies eg CMOs CIOs <p> <li> <li> <p> Communicate customer needs to OfferFits product amp marketing teams ensuring a customercentric product roadmap <p> <li> <ul> <p> <strong> Why is it great <strong> <p> <ul> <li> <p> Be the face of the company working alongside our customers to help them succeed <p> <li> <li> <p> Sell a product with strong productmarket fit the pain of manual experimentation is a real pain point for marketers leading to a high level of enthusiasm for our products <p> <li> <li> <p> Get strong support from leadership OfferFit prioritizes sales helping your team succeed will be a true priority for the CEO and other Sales leadership team members <p> <li> <li> <p> Lead the AI transformation happening in marketing technology today OfferFit is at the forefront so youll be in the middle of the action <p> <li> <li> <p> Join OfferFits fastpaced supportive and professional team We make sure all of our team members are empowered and receive great mentorship and coaching <p> <li> <ul> <p> <strong> Whos a fit <strong> <p> <ul> <li> <p> Executionfocused leader you can structure a plan align stakeholders and see it through to execution <p> <li> <li> <p> People person you build trustbased relationships with internal team members and external partners and combine empathy with a willingness to have direct challenging conversations <p> <li> <li> <p> Processdriven you can create scalable frameworks to optimize the success of business outcomes <p> <li> <li> <p> Entrepreneurial you take initiative work around obstacles and always seek creative ways to get to the next level <p> <li> <li> <p> Technology enthusiast you are passionate about new technologies and their potential to impact businessasusual <p> <li> <li> <p> Clear communicator you are able to express yourself clearly and persuasively both in writing and speech <p> <li> <li> <p> Sales expert you have a history of enterprise sales and are wellversed in SPIN selling amp MEDDPICC qualification methodology <p> <li> <ul> <p> The base salary range for this position in the United States is $81000$142000 per year plus eligibility for additional commissionbonus ranging $91000$162000 with an overall OTE of $172000$305000 ability to earn more based on sales goals Eligibility for an additional end of year performance bonus commissions when applicable andor equity options may be provided as part of the compensation package in addition to a full range of medical financial andor other benefits depending on the position offered For nonUS based candidates base pay and overall compensation packages will be adjusted based on location Applicants should apply via OfferFits internal or external careers site <p> <p> <strong> OfferFit Benefits and Perks <strong> <p> <ul> <li> <p> Generous PTO starting at 25 days PTO per year and Parental leave policy 12 weeks paid <p> <li> <li> <p> 100 remote work environment with flexible hours <p> <li> <li> <p> Quarterly gatherings where we meet in person in a different city to work together bond as a team and celebrate our progress <p> <li> <li> <p> Weekly team events lunch and learns trivia virtual escape rooms town hall and team health barometer meetings <p> <li> <li> <p> Ability to learn and develop from an experienced leadership team exAmazon McKinsey BCG and IBM among others who are focused on building a talented diverse and inclusive tea <p> <li> <li> <p> Dedication to building a strong culture eg team resource groups weekly recognitions major life event celebrations mental healthsustainability days off etc <p> <li> <li> <p> US Only Competitive benefits major medical vision dental and LTD and 401K matching program <p> <li> <ul><p>
Account Executive
Company: Warp
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> Were hiring our first seller to help execute Warps gotomarket motion and help technical buyers buy Warp at scale This job is not the typical account executive role You will be expected to break the snow and write playbooks All of your leads will be from the product You will be empowered to expand accounts and land and expand You will also work closely with Product and Engineering to shape the enterprise offering <p> <p> This is a great time for a first seller to join Warp Warp has built a muchloved product with a huge top of funnel of hundreds of thousands of active free users There is already early organic demand for enterprise leading to a decent pipeline You will get to take existing deals across the finishing line and convert the huge user base into more deals You will work directly with the founder on founderled sales and build the foundation of sales at Warp <p> <p> <strong> As our first Account Executive you will <strong> <p> <ul> <li> <p> Build relationships with key stakeholders within accounts and close deals <p> <ul> <li> <p> Work across the full sales cycle from sourcing to qualification to product demo to POC to procurement to implementation kickoff <p> <li> <li> <p> Help inbound leads procure Warp for their teams and organizations <p> <li> <li> <p> Generate a strong pipeline especially from our existing users <p> <li> <ul> <li> <li> <p> Cultivate existing accounts for engagement renewal and expansion ie you will also be responsible for account management and customer success <p> <li> <li> <p> Help shape GTM strategy and define sales processes and systems to support selling motions <p> <li> <li> <p> Learn from prospects and customers and bring those learnings back into our roadmap <p> <li> <li> <p> Help establish early partnerships with customers to validate enterprise product priorities <p> <li> <li> <p> Work with Growth on driving on an enterprise marketing and sales enablement strategy <p> <li> <ul> <p> <strong> You may be a good fit if <strong> <p> <ul> <li> <p> You have 5+ years experience in a quotacarrying sales role <p> <li> <li> <p> You have sold a technical SaaS product in the past <p> <li> <li> <p> You have experience working in an earlystage startup with a dynamic GTM motion <p> <li> <li> <p> You understand the productled sales motion <p> <li> <li> <p> You have a preference for sales experimentation <p> <li> <li> <p> You are excited to create and operationalize sales processes <p> <li> <li> <p> You are productminded and love generating customer insights through your conversations <p> <li> <li> <p> You are organized you can manage many sales conversations at once and are proactive about follow ups You understand the importance of making sure no prospect falls through the cracks <p> <li> <li> <p> You have demonstrated customer empathy and are focused on helping the customer solve their problems <p> <li> <li> <p> You have passion for learning more about the terminal and engineering workflowswhile you will have technical support you are unafraid to support deep technical discussions with the customer <p> <li> <li> <p> You have strong writing skills and are able to create your own sales collateral to get started <p> <li> <li> <p> Bonus <p> <ul> <li> <p> You have sold to engineering leaders before <p> <li> <li> <p> You were a Sales Engineer <p> <li> <li> <p> You have used the terminal <p> <li> <ul> <li> <ul> <p> At Warp we are dedicated to building a diverse inclusive and authentic workplace So if youre excited about this role but your past experience doesnt align perfectly with every qualification in this job description we encourage you to apply anyways We are a community of curious learners and most of us are learning some skills for the first time like our engineers learning to program Warp in Rust You might be just the right candidate for this or other roles <p> <p> <strong> Salary Transparency <strong> <p> <p> Total compensation at Warp consists of two parts 1 a competitive base salary and most importantly 2 meaningful equity <p> <p> When we find the right person we try to put our best foot forward with an offer that excites you We consider what youd like to be paid the skills and level of experience you bring what similar jobs pay and make sure theres equal pay for equal work among those youll be working with The budgeted compensation amount for this role is targeted at $180230K OTE <p><p>