Award-Winning Culture Jobs in USA

191,878 open positions · Updated daily

Looking for Award-Winning Culture jobs in USA? Browse our curated listings with transparent salary information to find the perfect Award-Winning Culture position in the USA area.

Client Development Director - Channel Partnerships

Company: StackAdapt

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <p> StackAdapt is a selfserve advertising platform that specializes in multichannel solutions including native display video connected TV audio ingame and digital outofhome ads We empower hundreds of digitallyfocused companies to deliver outcomes and exceptional campaign performance everyday StackAdapt was founded with a vision to be more than an advertising platform its a hub of innovation imagination and creativity <p> <p> <p> <p> Are you a proactive problem solver with a passion for programmatic advertising Are you a relationship builder with strong interpersonal communication skills If so then we want to hear from you Were looking for a Client Development Manager to join our expanding Channel Partnerships team in a specialist capacity <p> <p> <p> <p> You will become a foremost expert on the StackAdapt platform while owning the growth and success of enterprise level channel partners post sale The ideal candidate will manage a group of accounts with the goal of exceeding StackAdapts customer success standards building valuable relationships across executive and operator levels and driving new business using a consultative partner based sales approach <p> <p> <p> <p> Successful candidates will be self motivated with a strong track record of quickly understanding client technical needs and business objectives to recommend the right solutions to achieve goals <p> <p> <p> <p> StackAdapt is a Remote First company we are open to candidates located anywhere in the US for this position <p> <p> <p> <p> <p> <p> <strong> What youll be doing <strong> <p> <ul> <li> <p> Act as StackAdapts principle evangelist media thought leader problem solver and point of contact across your account portfolio <p> <li> <li> <p> Accurately forecast business needs and account growth while maintaining a clean pipeline of incremental opportunities <p> <li> <li> <p> Own build and run the rhythm of business across your portfolio through the use of status calls strategy calls office hours QBRs and more <p> <li> <li> <p> Identify and pitch key incremental sales opportunities develop client enablement plans and work cross functionally within StackAdapt to solve client needs and develop new opportunities <p> <li> <ul> <p> <p> <p> <strong> What youll bring to the table <strong> <p> <ul> <li> <p> High level of experience managing enterprise clients within the programmatic advertising space preferably at a Demand Side Platform Trading Desk or Media Agency <p> <li> <li> <p> Comfortable working within a quota based environment with a track record of exceeding targets and successfully growing account portfolios <p> <li> <li> <p> Positive energy proactive mentality highly organized with a growth mindset <p> <li> <li> <p> Bonus if you have worked with API based media clients at a Demand Side Platform <p> <li> <ul> <p> <p> <p> <strong> StackAdapters Enjoy <strong> <p> <ul> <li> <p> Competitive salary + commissions <p> <li> <li> <p> 401K matching <p> <li> <li> <p> 3 weeks vacation + 3 personal care days + 1 Culture amp Belief day + birthdays off <p> <li> <li> <p> Access to a comprehensive mental health care platform <p> <li> <li> <p> Health benefits from day one of employment <p> <li> <li> <p> Work from home reimbursements <p> <li> <li> <p> Optional global WeWork membership for those who want a change from their home office <p> <li> <li> <p> Robust training and onboarding program <p> <li> <li> <p> Coverage and support of personal development initiatives conferences courses etc <p> <li> <li> <p> Access to StackAdapt programmatic courses and certifications to support continuous learning <p> <li> <li> <p> Mentorship opportunities with industry leaders <p> <li> <li> <p> An awesome parental leave policy <p> <li> <li> <p> A friendly welcoming and supportive culture <p> <li> <li> <p> Our social and team events <p> <li> <ul> <p> <p> <p> <p> <p> <p> <p> <p> <p> <em> StackAdapt is a diverse and inclusive team of collaborative hardworking individuals trying to make a dent in the universe No matter who you are where you are from who you love follow in faith disability or superpower status ethnicity or the gender you identify with if youre comfortable let us know your pronouns you are welcome at StackAdapt If you have any requests or requirements to support you throughout any part of the interview process please let our Talent team know <em> <p> <p> <p> <p> <strong> About StackAdapt <strong> <p> <p> <p> <p> Weve been recognized for our diverse and supportive workplace high performing campaigns awardwinning customer service and innovation Weve been awarded <p> <p> <p> <p> <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpsblogstackadaptcomstackadaptnamedadagesbestplacetowork2024utmsource=linkedinamputmmedium=organicsocialamputmcampaign=adagesbestplacetowork2024amputmcontent=blog rel=noopener noreferrer nofollow target=blank> Ad Age Best Places to Work 2024 <a> <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpsblogstackadaptcomg22024bestsoftwareawards rel=noopener noreferrer nofollow target=blank> G2 Top Software and Top Marketing and Advertising Product for 2024 <a> <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpsblogstackadaptcom2023bestplacestoworkuk rel=noopener noreferrer nofollow target=blank> Campaigns Best Places to Work 2023 for the UK <a> <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpsblogstackadaptcombestworkplacesforwomenlist rel=noopener noreferrer nofollow target=blank> 2024 Best Workplaces for Women <a> and <a class=fontbold underline fontbold underline postingslink href=httpsblogstackadaptcom2023bestworkplacesincanadalist rel=noopener noreferrer nofollow target=blank> in Canada <a> by Great Place to Work® <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpswwwg2comproductsstackadaptreviews rel=noopener noreferrer nofollow target=blank> 1 DSP on G2 and leader in a number of categories including CrossChannel Advertising <a> <p> <p> <p> <p> LIRemote <p><p>

Senior Backend Engineer - Shared Services

Company: Webflow

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <p> At Webflow our mission is to bring development superpowers to everyone Webflow is the leading visual development platform for building powerful websites without writing code By combining modern web development technologies into one platform Webflow enables people to build websites visually saving engineering time while clean code seamlessly generates in the background From independent designers and creative agencies to Fortune 500 companies millions worldwide use Webflow to be more nimble creative and collaborative Its the web made better <p> <p> We are looking for a Senior Backend Engineer to join the Shared Services team to enable our engineering team to build more efficiently so we can further our mission of bringing visual development superpowers to everyone If youre passionate about engineering excellence and driving operational efficiency wed love to hear from you <p> <h2> <strong> About the role <strong> <h2> <ul> <li> <p> Location Remotefirst United States BC amp ON Canada <p> <li> <li> <p> Fulltime <p> <li> <li> <p> Permanent <p> <li> <li> <p> Exempt <p> <li> <li> <p> The cash compensation for this role is tailored to align with the cost of labor in different geographic markets Weve structured the base pay ranges for this role into zones for our geographic markets and the specific base pay within the range will be determined by the candidates geographic location jobrelated experience knowledge qualifications and skills <p> <ul> <li> <p> United States all figures cited below in USD and pertain to workers in the United States <p> <ul> <li> <p> Zone A $162500 $216050 <p> <li> <li> <p> Zone B $152700 $203100 <p> <li> <li> <p> Zone C $14300 $190150 <p> <li> <ul> <li> <li> <p> Canada All figures cited below in CAD and pertain to workers in ON amp BC Canada <p> <ul> <li> <p> CAD 184600 CAD 245500 <p> <li> <ul> <li> <ul> <li> <li> <p> Please visit our <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowaboutwebflowiocareers rel=noopener noreferrer nofollow target=blank> Careers page <a> for more information on which locations are included in each of our geographic pay zones However please confirm the zone for your specific location with your recruiter <p> <li> <li> <p> Reporting to the engineering manager <p> <li> <ul> <p> As Senior Backend Engineer youll <p> <ul> <li> <p> Develop a comprehensive knowledge of how areas of business such as architecture and infrastructure integrate to improve developer productivity and accomplish our business goals <p> <li> <li> <p> Collaborate with software engineers product managers designers and QA analysts in an autonomous supportive team environment <p> <li> <li> <p> Build and maintain shared services including but not limited to Inapp Email Notification platform and Feature Flag framework <p> <li> <li> <p> Identify develop and document APIs for Webflows service catalog as well as provide quick start guides for developer best practices <p> <li> <li> <p> Solve problems in a highly technical platform that empowers hundreds of engineers <p> <li> <li> <p> Improve our planning development and deployment processes to help you and your fellow team members <p> <li> <li> <p> Mentor coach and inspire a team of engineers of various levels <p> <li> <ul> <p> In addition to the responsibilities outlined above at Webflow we will support you in identifying where your interests and development opportunities lie and well help you incorporate them into your role <p> <h2> <strong> About you <strong> <h2> <p> Youll thrive in this role if you <p> <ul> <li> <p> Have 5+ years developing and deploying web applications with a proven track record of shipping to market <p> <li> <li> <p> Excellent organization and communication skills both verbal and written <p> <li> <li> <p> Have worked on complex issues where the analysis requires an indepth knowledge of the company and existing architecture <p> <li> <li> <p> Can debug production issues across services and multiple levels of the stack <p> <li> <li> <p> Take pride in taking ownership and driving projects to business impact <p> <li> <li> <p> Proven experience building complex web systems <p> <li> <li> <p> Are familiar with one or more Javascript type systems we use TypeScript here <p> <li> <li> <p> Are comfortable working in an agile safetofail environment <p> <li> <ul> <p> <strong> Our Core Behaviors <strong> <p> <ul> <li> <p> <strong> Obsess over customer experience <strong> We deeply understand <em> what <em> were building and <em> who <em> were building for and serving We define the leading edge of whats possible in our industry and deliver the future for our customers <p> <li> <li> <p> <strong> Move with heartfelt urgency <strong> We have a healthy relationship with impatience channeling it thoughtfully to show up better and faster for our customers and for each other Time is the most limited thing we have and we make the most of every moment <p> <li> <li> <p> <strong> Say the hard thing with care <strong> Our best work often comes from intelligent debate critique and even difficult conversations We speak our minds and dont sugarcoat things and we do so with respect maturity and care <p> <li> <li> <p> <strong> Make your mark <strong> We seek out new and unique ways to create meaningful impact and we champion the same from our colleagues We work as a <em> team <em> to get the job done and we go out of our way to celebrate and reward those going above and beyond for our customers and our teammates <p> <li> <ul> <h3> <strong> Benefits amp wellness <strong> <h3> <ul> <li> <p> Equity ownership RSUs in a growing privatelyowned company <p> <li> <li> <p> 100 employerpaid healthcare vision and dental insurance coverage for employees and dependents fulltime employees working 30+ hours per week as well as Health Savings AccountHealth Reimbursement Account dependent care Flexible Spending Account US only dependent on insurance plan selection where applicable in the respective country of employment Employees may also have voluntary insurance options such as life disability hospital protection accident and critical illness where applicable in the respective country of employment <p> <li> <li> <p> 12 weeks of paid parental leave for both birthing and nonbirthing caregivers as well as an additional 68 weeks of pregnancy disability for birthing parents to be used before child bonding leave where local requirements are more generous employees receive the greater benefit Employees also have access to family planning care and reimbursement <p> <li> <li> <p> Flexible PTO with a mandatory annual minimum of 10 days paid time off for all locations where local requirements are more generous employees receive the greater benefit and sabbatical program <p> <li> <li> <p> Access to mental wellness and professional coaching therapy and Employee Assistance Program <p> <li> <li> <p> Monthly stipends to support health and wellness smart work and professional growth <p> <li> <li> <p> Professional career coaching internal learning amp development programs <p> <li> <li> <p> 401k plan and pension schemes in countries where statutorily required financial wellness benefits like CPA or financial advisor coverage <p> <li> <li> <p> Discounted Pet Insurance offering US only <p> <li> <li> <p> Commuter benefits for inoffice employees <p> <li> <ul> <h3> <strong> Be you with us <strong> <h3> <p> At Webflow equality is a core tenet of our culture We are an Equal Opportunity EEOVeteransDisabled Employer and are <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomdiversityequityinclusion rel=noopener noreferrer nofollow target=blank> committed <a> to building an inclusive global team that represents a variety of backgrounds perspectives beliefs and experiences Employment decisions are made on the basis of jobrelated criteria without regard to race color religion sex sexual orientation gender identity national origin disability veteran status or any other classification protected by applicable law Pursuant to the San Francisco Fair Chance Ordinance Webflow will consider for employment qualified applicants with arrest and conviction records <p> <h3> <strong> Stay connected <strong> <h3> <p> Not ready to apply but want to be part of the Webflow community Consider following our story on our <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomblog rel=noopener noreferrer nofollow target=blank> Webflow Blog <a> <a class=fontbold underline fontbold underline fontbold underline href=httpswwwlinkedincomcompanywebflowinc rel=noopener noreferrer nofollow target=blank> LinkedIn <a> <a class=fontbold underline fontbold underline fontbold underline href=httpstwittercomwebflow rel=noopener noreferrer nofollow target=blank> X Twitter <a> andor <a class=fontbold underline fontbold underline fontbold underline href=httpswwwglassdoorcomReviewsWebflowReviewsE890506htm rel=noopener noreferrer nofollow target=blank> Glassdoor <a> <p> <h3> <strong> Please note <strong> <h3> <p> <em> To join Webflow youll need valid US or Canadian work authorization depending on the country of employment <em> <p> <p> <em> If you are extended an offer that offer may be contingent upon your successful completion of a background check which will be conducted in accordance with applicable laws We may obtain one or more background screening reports about you solely for employment purposes <em> <p> <p> <em> For information about how Webflow processes your personal information please review <em> <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomlegalapplicantprivacynotice rel=noopener noreferrer nofollow target=blank> <em> Webflows Applicant Privacy Notice <em> <a> <em> <em> <p> <p> <p><p>

Senior Software Engineer - Cosmos Platform

Company: Bishop Fox

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <p> Bishop Fox is the leading authority in offensive security providing solutions ranging from continuous penetration testing red teaming and attack surface management to product cloud and application security assessments Weve worked with more than a quarter of the Fortune 100 half of the Fortune 10 eight of the top 10 global technology companies and all of the top global media companies Our Cosmos platform service innovation and culture of excellence continue to gather accolades from industry award programs including Fast Company Inc SC Media and others For more than 16 years weve been contributing and giving back to the security community Weve published more than 16 open source tools and 50 security advisories in the last five years alone Learn more at bishopfoxcom or follow us on social media <p> <p> Given our exceptional growth we are expanding and hiring a Software Engineer to join us on this exciting journey At Bishop Fox you will join a company of brilliant technologists to help build THE platform for offensive security Cosmos Working on Cosmos you will have the opportunity to build eventdriven domainoriented services across a wide spectrum of offensive security capabilities Each day will bring new challenges and problems to solve If you have strong experience with modern architecture cloud and languages such as Golang and Python are selfmotivated and enjoy solving problems at scale then the Cosmos Platform Engineering team is for you Bring your experience curiosity and will to deliver great technology and join our Cosmos Platform team <p> <h3> Responsibilities <h3> <p> As a member of the Cosmos Platform Engineering team you will design solutions write code and usher software into production You will build services that industrialize the automation of offensive security processes and provide security information to our customers in a scalable secure reliable cloud platform <p> <p> As a Senior Engineer you will take the lead on design solutions drive quality standards and provide technical leadership to the team and broader engineering organization <p> <h3> Requirements <h3> <ul> <li> <p> 5+ years of software development experience <p> <li> <li> <p> Professional experience with Golang or Python required <p> <li> <li> <p> Mastery in the foundations of Golang or Python and strong experience in building microservices in the specified language <p> <li> <li> <p> Experience in a professional software organization using an SDLC <p> <li> <li> <p> Understanding of coding best practices structure patterns unit tests secure coding etc <p> <li> <li> <p> Ability to work independently and also work together with the team to solve complex technical problems <p> <li> <ul> <h3> Preferred Skills and Experience <h3> <ul> <li> <p> Experience with Amazon Web Services AWS <p> <li> <li> <p> Eventdriven and asynchronous systems Rabbit SQS SNS Kafka Kinesis etc <p> <li> <li> <p> Experience using datastores SQL or NoSQL <p> <li> <li> <p> An interest in cybersecurity <p> <li> <ul> <p> Bishop Fox has always allowed its employees to work remotely and this role could work anywhere in the United States Our comprehensive benefits program is tailored to meet your needs at an affordable price We embrace diversity and an inclusive culture We value our employees and who they are which fosters a powerful and collective talent base to successfully serve our clients and the security community with unparalleled expertise <p> <p> <em> Bishop Fox is an Equal Opportunity employer All qualified applicants will receive consideration for employment without regard to race color religion sex including sexual orientation and gender identity national origin disability protected veteran status or any other characteristic protected by applicable federal state or local law All new hires must pass a background check as a condition of employment <em> <p> <p> Interested Apply today <p><p>

Senior Director of Integrated Media

Company: Code.org

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <h2> <strong> JOB SUMMARY <strong> <h2> <p> The Senior Director of Media will lead the strategic direction and execution of all paid earned and owned media initiatives to elevate Codeorgs brand and mission This role is responsible for crafting highimpact media strategies that effectively reach target audiences managing media budgets to ensure maximum ROI and forging strategic partnerships to enhance our media presence <p> <h2> <strong> DUTIES AND RESPONSIBILITIES <strong> <h2> <p> Integrated Media Strategy <p> <ul> <li> <p> Develop and execute a unified media strategy that seamlessly integrates paid earned and owned channels ensuring consistent messaging and optimal audience engagement across all platforms to amplify Codeorgs mission and organizational goals <p> <li> <li> <p> Establish and nurture strategic connections and partnerships with media platforms agencies and other relevant organizations to unlock new media opportunities and collaborations <p> <li> <li> <p> Stay at the forefront of media trends and technological advancements adapting and innovating media strategies to maintain competitiveness and relevance in the digital landscape <p> <li> <li> <p> Collaborate closely with marketing and creative teams to ensure seamless integration of media plans with broader marketing campaigns and content strategies <p> <li> <ul> <p> Paid Media Leadership <p> <ul> <li> <p> Focus on strategically investing in paid media channels to target specific audiences enhance visibility and drive measurable outcomes Utilize datadriven insights to allocate budgets effectively continuously optimizing campaigns for maximum ROI <p> <li> <li> <p> Strategically leverage existing partnerships to maximize opportunities for grants and PSAs ensuring optimal placement and exposure to support Codeorgs mission and amplify its impact on a larger scale <p> <li> <ul> <p> Earned Media Leadership <p> <ul> <li> <p> Maximize earned media opportunities through compelling storytelling media relations and influencer partnerships Aim to amplify Codeorgs visibility and credibility by securing coverage and endorsements that resonate with our mission and values <p> <li> <li> <p> Work collaboratively with partners to cocreate and launch impactful campaigns that align with mutual objectives driving increased engagement and support for educational initiatives <p> <li> <ul> <p> Owned Media Leadership <p> <ul> <li> <p> Implement a dynamic social media strategy across Codeorgs platforms to engage audiences share insights and foster community Oversee the social media community management team ensuring active social discussions and participation while maintaining a welcoming environment <p> <li> <li> <p> Enhance Codeorg executives online presence through strategic use of speaking engagements and social media positioning them as key voices in computer science education Oversee the event execution team ensuring all events align with our mission and enhance our objectives <p> <li> <ul> <p> Media Reporting and Analysis <p> <ul> <li> <p> Define clear measurable key performance indicators KPIs tailored to each campaigns objectives ensuring alignment with overall business goals <p> <li> <li> <p> Develop comprehensive media reporting frameworks to track campaign performance across all channels utilizing data analytics to provide actionable insights and detailed postcampaign analysis for continuous improvement <p> <li> <li> <p> Implement ongoing optimization strategies based on realtime data adjusting media placements channel focus and budget allocation to enhance campaign performance and maximize return on investment ROI <p> <li> <li> <p> Establish learning agendas for all major campaigns to test hypotheses and new strategies fostering a culture of innovation and ensuring the media strategy evolves with changing market dynamics <p> <li> <ul> <p> Media Operations Efficiency <p> <ul> <li> <p> Streamline media operations to enhance campaign execution and delivery ensuring seamless integration of planning buying and realtime adjustments across all media channels <p> <li> <li> <p> Oversee the precise trafficking of advertising materials coordinating with creative and media teams to ensure ads are correctly formatted targeted and delivered on schedule <p> <li> <ul> <h2> <strong> EXPERIENCE amp QUALIFICATIONS <strong> <h2> <p> We seek candidates who have <p> <ul> <li> <p> Bachelors degree in Marketing Advertising Communications or a related field <p> <li> <li> <p> Minimum of 10 years of experience in media planning and buying with a significant focus on paid media strategies and execution <p> <li> <li> <p> Proven track record of developing and managing largescale media campaigns that have delivered measurable results <p> <li> <li> <p> Strong analytical skills with expertise in ROI analysis and media metrics <p> <li> <li> <p> Exceptional negotiation and relationshipbuilding skills <p> <li> <ul> <p> We prefer candidates who also have <p> <ul> <li> <p> Experience in the nonprofit or education sector <p> <li> <li> <p> Familiarity with global media strategies and multimarket campaigns <p> <li> <li> <p> Leadership experience with the ability to inspire and guide a team towards achieving shared goals <p> <li> <ul> <p> In addition candidates must <p> <ul> <li> <p> Be a US Citizen or Permanent Resident <p> <li> <li> <p> Pass a preemployment background check <p> <li> <li> <p> Be willing to travel a minimum of two times per year for team events <p> <li> <ul> <p> <p> <h2> <strong> WHAT IS THE INTERVIEW PROCESS LIKE <strong> <h2> <p> Step 1 Informational Interview learn more about the role and share your experience 30 minutes <p> <p> Step 2 Homework ~3 hours <p> <p> Step 3 Interviews with several members of the Codeorg team ~ 3 hours <p> <p> Step 4 Final Interview 1hour <p> <p> Step 5 Reference Checks <p> <p> <u> <em> All interviews are currently being conducted virtually via Zoom <em> <u> <p> <p> <p> <h2> <strong> TO APPLY <strong> <h2> <p> The priority application date for this role is <strong> March 8 2024 <strong> and preference will be given to applications submitted by this date Our team will review all applications and if we believe your qualifications would make a great fit well contact you to schedule an informational interview <p> <h2> <strong> COMPENSATION amp BENEFITS PACKAGE <strong> <h2> <p> The expected salary range for this position is $150000$170000 The actual offer will be at the companys sole discretion and determined by relevant business considerations including the final candidates qualifications years of experience and skillset <p><p>

Research Associate - siRNA/Peptides + Antibody

Company: Vial

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <p> <strong> Who We Are <strong> <p> <p> <p> <p> Vial is a global techdriven CRO providing nextgeneration clinical trial management services The Vial CRO powers its drug discovery arm Battery Bio an AIpowered hyper scalable biotech Battery Bio harnesses Vials unique 90 lower cost structure to produce more affordable drug development with efficient streamlined clinical trials <p> <p> <p> <p> Our mission is to reimagine the drug discovery process to empower scientists to cure all human disease We have assembled a talented team of clinical operators chemists and innovative thinkers to achieve this vision <p> <p> <p> <p> Vial is a San Francisco Californiabased company founded by Simon Burns in October 2020 Since our founding we have become a fastgrowing company of 100+ employees with over $100 million in funding from esteemed investors including General Catalyst Box Group and Byers Capital <p> <p> <p> <p> Vial is rebuilding the infrastructure to advance research By deploying technology at every step we are creating a more efficient future for drug discovery <p> <p> <p> <p> <strong> What Youll Do <strong> <p> <p> Work in a structurebased computationally driven drug discovery paradigm <p> <p> Iteratively scale rethink and collaborate on a drug discovery engine that will scale to hundreds of programs <p> <p> Work on assay development and process development for Vials in house discovery efforts <p> <p> Research new modalities + new approaches and serve as a thought partner to the team <p> <p> Work with other scientists clinicians computational biologists project managers and external partners to accomplish our mission of curing diseases <p> <p> <p> <p> <strong> What Youll Bring <strong> <p> <p> 35 years of experience in Antibody discoveryprogram development or roles directly related to the Research amp Development of antibody programs <p> <p> Entrepreneurial mindset experience in startup environment preferred a plus <p> <p> Deeply analytical systems thinker focused on finding scalable solutions <p> <p> <p> <p> <p> <p> <p> <p> $90000 $110000 a year <p> <p> <strong> Why Youll Love Working At Vial <strong> <p> <p> <p> <p> <strong> We are innately curiosity <strong> We found our calling in clinical trials after learning the pain points directly It is our curiosity that propels us to keep building finding new challenges and fulfilling our vision of reimagining clinical trials <p> <p> <strong> We believe in autonomy <strong> Team members do their best work when given autonomy In order to make an impact on the scale of the Vial vision we built our culture to enable each Vial team member to feel ownership of their domain <p> <p> <strong> We take pride in building mastery <strong> We believe in building master in a craft Craftsmanship a pride in ones craft is key to prolonged engagement on a difficult challenge Vials culture is one of highly autonomous deeply focused experts working on an immensely hard problem together <p> <p> <strong> Our strength is moving fast and staying humble <strong> We believe that if we build a team that is intellectually honest that we stay nimble and keep an open mind to all solutions well be adaptive and solve the problems that face us at every turn <p> <p> <p> <p> <strong> Benefits <strong> <em> Not applicable to Contract or Temp Positions <em> <p> <p> Competitive Equity Compensation <p> <p> Comprehensive benefits package including Medical Dental and Vision insurance <p> <p> 401k or RRSP Plan with Company Matching after first 90 days of employment <p> <p> One time Remote Office Setup Stipend <p> <p> Paid Parental Leave <p> <p> RemoteFirst Flexible Work Schedule <p> <p> Unlimited Vacation <p> <p> <p><p>

Director - Corporate FP&A

Company: Icertis

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <p> With unmatched technology and categorydefining innovation Icertis pushes the boundaries of whats possible with contract lifecycle management CLM The AIpowered analystvalidated Icertis Contract Intelligence ICI platform turns contracts from static documents into strategic advantage by structuring and connecting the critical contract information that defines how an organization runs Today the worlds most iconic brands and disruptive innovators trust Icertis to fully realize the intent of their combined 10 million contracts worth more than $1 trillion in 40+ languages and 93 countries <p> <p> <p> <p> <strong> Who we are <strong> Icertis is the only contract intelligence platform companies trust to keep them out in front now and in the future Our unwavering commitment to contract intelligence is grounded in our FORTE valuesFairness Openness Respect Teamwork and Executionwhich guide all our interactions with employees customers partners and stakeholders Because in our mission to be the contract intelligence platform of the world we believe how we get there is as important as the destination <p> <p> <p> <p> As the Director of FPampA you will play a critical leadership role you will work closely with all of companys functional leaders and bring key market strategic and operational insights that will shape the direction of the company and accelerate its growth You will also play a key role in telling the companys financial story to investors <p> <p> <p> <p> The ideal candidate will have a proven trackrecord of driving business outcomes through keen financial insight and business modeling They will have the ability to create a 360degree financial picture of the business that reflects and influences the companys strategy and be excellent at communicating with senior leaders and executives They will be toolsavvy with experience in creating scalable data and reporting solutions that support a datadriven culture LIRS1 <p> <p> <p> <p> <p> <p> <strong> What you will do <strong> <p> <ul> <li> <p> Formulate a robust 360degree financial picture of the business complete with market insights and operational drivers <p> <li> <li> <p> Develop and maintain the 3year Strategic Planning Model and forecast <p> <li> <li> <p> Deliver Global PampL and cash flow forecasts <p> <li> <li> <p> Drive Annual Planning Process work cross functionally to build and maintain the Annual Financial Plan and Departmental Budgets <p> <li> <li> <p> Build and deliver Business Performance ReportingOperating dashboards <p> <li> <li> <p> Perform strategic business analysis as needed MampA Geo Expansion <p> <li> <li> <p> Prepare financial analyses as needed to help drive improvements in the business Current focus areas include market expansion opportunities competitive benchmarking analyses pricing and strategic financial optimization strategies <p> <li> <li> <p> Partner with Controller to enhance and accelerate the financial reporting process <p> <li> <li> <p> Identifies and implements system and process improvements to increase the efficiency and effectiveness of planning and reporting workflows <p> <li> <li> <p> Prepare communications to Board of Directors <p> <li> <li> <p> Drive investor presentations and supporting analysis <p> <li> <li> <p> Develop a deep understanding of the business metrics with an eye towards understanding the benefits and risks from a financial perspective and helping to manage key business drivers and desired outcomes <p> <li> <li> <p> Play a key role in preparation of critical public financial documents to support the IPO process including working with bankers and supporting the production of investor materials and SEC filings eg S1 <p> <li> <ul> <p> <p> <p> <strong> What you will bring <strong> <p> <ul> <li> <p> 12+ years of experience of working in direct strategic analysis support of all aspects of the business at all areas of the PampL <p> <li> <li> <p> MBACPA or equivalent experience preferred <p> <li> <li> <p> Demonstrated complex modeling experience this is a handson role and managers are expected to directly contribute and lead by example <p> <li> <li> <p> Highly analytical detailoriented with a commitment to creating a highquality product Naturally inquisitive and able to extract information from various sources to identify and understand the underlying issue Not afraid to question results <p> <li> <li> <p> Prior success working in a fastpaced entrepreneurial environment takes initiative and works independently <p> <li> <li> <p> Working knowledge of accounting principles required including revenue recognition amortization and accrual vs cash accounting Must have a general understanding of financial statements <p> <li> <li> <p> Must have exceptional written visual and spoken communication skills <p> <li> <li> <p> Experience in preparing and delivering executive board and investor level communications <p> <li> <li> <p> IPO experience is a plus <p> <li> <li> <p> Must have advanced Excel Netsuite and Powerpoint skills <p> <li> <li> <p> Experience implementing financial analysis and planning tools required <p> <li> <ul> <p> <p> <p> <p> <p> $146000 $219000 a year <p> <p> <em> Pay offered will vary based on jobrelated factors such as location experience training skills and abilities In addition to the base salary and annual bonus target and an equity component is included in the compensation package <em> <p> <p> <strong> What we offer <strong> <p> <p> We are committed to the health and wellbeing of all Icertians their families the communities they live in and our customers This commitment is represented in the Icertis Four Rings of Responsibility Take Care of Self Take Care of Family Take Care of Community and Take Care of Business in that order <p> <p> <p> <p> To support these commitments Icertis offers excellent health and welfare benefits a generous 401k match and a robust paid time off program Here are some of the other reasons <a class=fontbold underline fontbold underline postingslink href=httpswwwicertiscomcompanynewsicertisplacesfirstinwashingtons100bestcompaniestoworkfor rel=noopener noreferrer nofollow target=blank> Icertis Places First in Washingtons 100 Best Companies to Work For | Icertis <a> <p> <p> <p> <p> ● Equity RSUs and shared ownership in the company <p> <p> ● Flexible work environment <p> <p> ● Paid maternity and paternity leave <p> <p> ● 7 Days for Humanity 7 paid volunteer days <p> <p> ● Generous holidays including the 4th of July week off paid <p> <p> ● Free professional and leadership coaching <p> <p> ● Annual personal development allowance <p> <p> <p> <p> Icertis Inc provides Equal Employment Opportunity to all employees and applicants for employment without regard to race color religion gender identity or expression sex sexual orientation national origin age disability genetic information marital status amnesty or status as a covered veteran in accordance with applicable federal state and local laws Icertis Inc complies with applicable state and local laws governing nondiscrimination in employment in every location in which the company has facilities If you are in need of accommodation or special assistance to navigate our website or to complete your application please send an email with your request to <a class=fontbold underline fontbold underline postingslink href=mailtocareersicertiscom rel=noopener noreferrer nofollow target=blank> careersicertiscom <a> or get in touch with your recruiter <p> <p> <p> <p> By submitting your application you acknowledge that you have read Icertiss Privacy Policy <a class=fontbold underline fontbold underline postingslink href=httpswwwicertiscomprivacystatement rel=noopener noreferrer nofollow target=blank> httpswwwicertiscomprivacystatement <a> <p> <p> <p> <p> Icertis is not open to third party solicitation or resumes for our posted FTE positions Resumes received from third party agencies that are unsolicited will be considered complimentary <p><p>

Distributed Systems Engineer, L5 - OC Tools Runtime

Company: Netflix

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <p> How do you spark joy in hundreds of millions of people It starts with a vision that technology can give voice to stories around the world In delivering those muchloved stories Netflix is responsible for a significant portion of global internet traffic <p> <p> <p> <p> To steward that responsibility we work collaboratively with ISPs to deploy <a class=fontbold underline fontbold underline postingslink href=httpsmedianetflixcomencompanybloghownetflixworkswithispsaroundtheglobetodeliveragreatviewingexperience rel=noopener noreferrer nofollow target=blank> Open Connect <a> Netflixs Content Delivery Network CDN which delivers 100 of Netflixs video traffic Our teams mission is to support that delivery by providing an automation and tooling platform that supports the internal operations and external partnerships needed to provide a fantastic viewing experience for all Netflix members We are looking for a talented software engineer specializing in infrastructure to join us on that mission <p> <p> <p> <p> <strong> The Role <strong> <p> <p> You will be charged with handling impactful availability scalability and usability challenges and must selfdefine optimal ways to configure manage and observe our growing Open Connect platform Our platform is a fundamental building block to our streaming initiatives providing critical solutions for one of the worlds largest CDNs and empowering stakeholders to operate the CDN more efficiently and reliably <p> <p> <p> <p> <p> <p> <p> <p> <strong> In this position you will have the opportunity to work in a wide variety of areas such as <strong> <p> <ul> <li> <p> Implementing microservices to enable analytics insights discovery and visualizations <p> <li> <li> <p> Designing orchestration to manage many thousands of globally distributed appliances and devices <p> <li> <li> <p> Building data models and APIs to help manage and maintain our fleet <p> <li> <li> <p> Understanding the breadth of our multitenant platform creating generalized solutions which can be leveraged across multiple domains including networking video and gaming <p> <li> <ul> <p> <p> <p> <strong> You Are <strong> <p> <ul> <li> <p> Someone who likes to work handson and selfdirect in a fastpaced environment that gives you great freedom and responsibility <p> <li> <li> <p> Able to see beyond immediate specifications can summarize requirements and architect forwardlooking solutions that cross multiple applications <p> <li> <li> <p> Capable of working in a highlycollaborative environment alongside your teammates engineers Partner Engagement Managers project managers and operations teams <p> <li> <li> <p> Articulate in communicating opportunities for continuous improvements to existing systems with a clear understanding of the impact on the business <p> <li> <li> <p> Always striving to develop and deploy in measured increments while taking responsibility for the quality of your work <p> <li> <ul> <p> <p> <p> <strong> Required Skills <strong> <p> <ul> <li> <p> 5+ years of expertise in Java or similar objectoriented language with confidence and experience in debugging and problemsolving skills <p> <li> <li> <p> Deep understanding of cloud architecture and application deployment <p> <li> <li> <p> Ability to build and support highly scalable robust and faulttolerant services <p> <li> <li> <p> Comprehensive knowledge of architecting and maintaining largescale distributed systems while handling high concurrency <p> <li> <li> <p> Experience designing implementing and debugging systems that interact with largesized data sets <p> <li> <li> <p> Excellent verbal and written communication skills <p> <li> <ul> <p> <p> <p> <strong> Bonus Skills <strong> <p> <ul> <li> <p> Knowledge of CDN architectures and networking fundamentals TCPIP BGP DNS <p> <li> <li> <p> Experience with multiple data stores and streaming services such as MySQL Postgres Elasticsearch Cassandra Kafka or Redis <p> <li> <li> <p> Familiarity with GraphQL or related graph modeling and querying concepts <p> <li> <li> <p> Handson Big Data experience using Hive Pig Hadoop or similar <p> <li> <li> <p> Understanding of frontend technologies including HTML CSS JavaScript WebSockets <p> <li> <ul> <p> <p> <p> <p> <p> Does this sound interesting Or does this sound interesting but intimidating Please dont selfselect out lets figure it out together Wed love to talk to you <p> <p> <p> <p> Our culture is unique and we tend to live by our values so its worth learning more about Netflix <a class=fontbold underline fontbold underline postingslink href=httpsjobsnetflixcomculture rel=noopener noreferrer nofollow target=blank> here <a> <p> <p> <p> <p> Our compensation structure consists solely of an annual salary we do not have bonuses You choose each year how much of your compensation you want in salary versus stock options To determine your personal top of market compensation we rely on market indicators and consider your specific job family background skills and experience to determine your compensation in the market range The range for this role is $100000 $720000 <p> <p> <p> <p> Netflix provides comprehensive benefits including Health Plans Mental Health support a 401k Retirement Plan with employer match Stock Option Program Disability Programs Health Savings and Flexible Spending Accounts Familyforming benefits and Life and Serious Injury Benefits We also offer paid leave of absence programs Fulltime hourly employees accrue 35 days annually for paid time off to be used for vacation holidays and sick paid time off Fulltime salaried employees are immediately entitled to flexible time off See more detail about our Benefits <a class=fontbold underline fontbold underline postingslink href=httpsjobsnetflixcomworklifephilosophy rel=noopener noreferrer nofollow target=blank> here <a> <p> <p> <p> <p> Netflix is a unique culture and environment Learn more <a class=fontbold underline fontbold underline postingslink href=httpsjobsnetflixcomculture rel=noopener noreferrer nofollow target=blank> here <a> <p> <p> <p> <p> We are an equalopportunity employer and celebrate diversity recognizing that diversity of thought and background builds stronger teams We approach diversity and inclusion seriously and thoughtfully We do not discriminate on the basis of race religion color ancestry national origin caste sex sexual orientation gender gender identity or expression age disability medical condition pregnancy genetic makeup marital status or military service <p><p>

Software Engineer - Seller Experience

Company: Whatnot

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <h2> <strong> 🚀 Whatnot <strong> <h2> <p> Whatnot is a livestream shopping platform and marketplace backed by Andreessen Horowitz Y Combinator and CapitalG Were building the future of ecommerce bringing together community shopping and entertainment We are committed to our <a class=fontbold underline fontbold underline fontbold underline href=httpswwwwhatnotcomcareers rel=noopener noreferrer nofollow target=blank> values <a> and as a remotefirst team we operate out of hubs within the US Canada UK Ireland and Germany today <p> <p> Were innovating in the fastpaced world of live auctions in categories including sports fashion video games and streetwear The platform couples rigorous seller vetting with a focus on community to create a welcoming space for buyers and sellers to share their passions with others <p> <p> And were growing Whatnot has been the <a class=fontbold underline fontbold underline fontbold underline href=httpsa16zcommarketplace100 rel=noopener noreferrer nofollow target=blank> fastest growing marketplace <a> in the US over the past two years and were hiring forwardthinking problem solvers across all functional areas <p> <h2> <strong> 💻 Role <strong> <h2> <p> The Seller Experience team plays a crucial role in empowering our community of sellers with tools and experiences that allow them to succeed and grow on Whatnot You will be at the forefront of developing scalable user friendly solutions that enhance the seller journey at every step of the lifecycle from onboarding scaling and growth The problems you will tackle span from Casual Resellers to Large Retailers <p> <h2> <strong> 👋 You <strong> <h2> <p> Curious about who thrives at Whatnot Weve found that low ego a growth mindset and leaning into action and high impact goes a long way here <p> <p> As our next Software Engineer you should have 5+ years of generalist software engineering experience at a fast growing technology company plus <p> <ul> <li> <p> We primarily use Python JavaScript Elixir and are open to others <p> <li> <li> <p> Excellent product instincts You first think about users rather than the best technical solution <p> <li> <li> <p> You are known for shipping products and features lightningfast <p> <li> <li> <p> Youre an excellent problem solver and dont need to be told exactly what to do <p> <li> <li> <p> Comfortable working across the stack backend and frontend <p> <li> <li> <p> Ability to pick up on new technologies very quickly <p> <li> <li> <p> Proven track record of delivering features <p> <li> <li> <p> Bonus Experience building technology in ecommerce contributing to seller experiences and success <p> <li> <ul> <h2> <strong> 💰Compensation <strong> <h2> <p> For USbased applicants <strong> <strong> $178000year to $235000year + benefits + stock options <p> <p> The salary range may be inclusive of several levels that would be applicable to the position Final salary will be based on a number of factors including level relevant prior experience skills and expertise This range is only inclusive of base salary not benefits more details below or equity in the form of stock options <p> <h2> <strong> 🎁 Benefits <strong> <h2> <ul> <li> <p> Flexible Time off Policy and Companywide Holidays including a spring and winter break <p> <li> <li> <p> Health Insurance options including Medical Dental Vision <p> <li> <li> <p> Work From Home Support <p> <ul> <li> <p> $1000 home office setup allowance <p> <li> <li> <p> $150 monthly allowance for cell phone and internet <p> <li> <ul> <li> <li> <p> Care benefits <p> <ul> <li> <p> $450 monthly allowance on food <p> <li> <li> <p> $500 monthly allowance for wellness <p> <li> <li> <p> $5000 annual allowance towards Childcare <p> <li> <li> <p> $20000 lifetime benefit for family planning such as adoption or fertility expenses <p> <li> <ul> <li> <li> <p> Retirement 401k offering for Traditional and Roth accounts in the US employer match up to 4 of base salary and Pension plans internationally <p> <li> <li> <p> Parental Leave <p> <ul> <li> <p> 16 weeks of paid parental leave + one month gradual return to work company leave allowances run concurrently with country leave requirements which take precedence <p> <li> <ul> <li> <ul> <h2> <strong> 💛 EOE <strong> <h2> <p> Whatnot is proud to be an Equal Opportunity Employer We value diversity and we do not discriminate on the basis of race religion color national origin gender sexual orientation age marital status veteran status parental status disability status or any other status protected by local law We believe that our work is better and our company culture is improved when we encourage support and respect the different skills and experiences represented within our workforce <p><p>

Customer Experience and Insights Manager - Enterprise

Company: Upwork

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <p> Upwork $UPWK is the worlds work marketplace We serve everyone from oneperson startups to large Fortune 100 enterprises with a powerful trustdriven platform that enables companies and talent to work together in new ways that unlock their potential <p> <p> Last year more than $38 billion of work was done through Upwork by skilled professionals who are gaining more control by finding work they are passionate about and innovating their careers <p> <p> If youre an experienced CX leader whos ready to use data storytelling and insights to drive our teams to improve customers lives then this may be your dream job As the Customer Experience Manager for Upworks Enterprise Business Unit you will lead our VoC Voice of Customer function for Upworks Enterprise clients This role owns Enterprise VoC endtoend and will work with key stakeholders to ensure we are hearing from our customers throughout their journey and lifecycle You will report to the Director Customer 360 Advocacy <p> <h3> <strong> Your Responsibilities <strong> <h3> <ul> <li> <p> <strong> Drive VoC data collection <strong> Run our Enterprise NPS survey and partner with Enterprise stakeholders and product managers to identify opportunities for additional listening posts to capture customer feedback <p> <li> <li> <p> <strong> Build our VoC Enterprise journey maps <strong> Identify gaps in our understanding of the Enterprise experience to help us create a comprehensive 360° view of these customer journeys <p> <li> <li> <p> <strong> Interpret data <strong> Dive into data across sources from NPS surveys to everything in our natural language processing vendor unitQ to identify themes at scale and extrapolate statistically significant insights <p> <li> <li> <p> <strong> Communicate with strategic focus amp clarity <strong> Employ exceptional communication skills to deliver quantifiable and actionable insights to teammates leaders and stakeholders at various levels of the business <p> <li> <li> <p> <strong> Empathetic storytelling <strong> Engage both the head and heart for our Enterprise product leaders and teams providing them the understanding they need to prioritize and accomplish our customer experience goals <p> <li> <li> <p> <strong> Make prioritized and compelling recommendations <strong> Influence product roadmaps through compelling datadriven storytelling and business cases using operational customer and financial data so outputs meet business needs and are strategically aligned <p> <li> <li> <p> <strong> Learn the Enterprise product <strong> become an expert in the Upwork Enterprise product from the customers perspective <p> <li> <li> <p> <strong> Insights to action <strong> Manage our customer experience database for all Enterprise experiences ensuring all pain points are captured categorized and prioritized for product teams to take action <p> <li> <li> <p> <strong> Closedloop methodologies <strong> Educate and empower Enterprise teams to closetheloop with our customers including issue resolution prevention and communication <p> <li> <li> <p> <strong> Systems thinker <strong> Zoom out to see the big picture and dive into the details when appropriate keeping a pulse on the organizations larger strategy <p> <li> <ul> <h3> <strong> What it Takes to Catch our Eye <strong> <h3> <ul> <li> <p> Certified Customer Experience Professional CCXP <p> <li> <li> <p> Proven track record driving positive change in a complex environment <p> <li> <li> <p> Understands CX methods and tools ex NPS CES closedloop systems journey mapping <p> <li> <li> <p> Group facilitation skills with experience running internal workshops andor external customer advisory boards <p> <li> <li> <p> Experience delivering insights reports to crossfunctional teams including ability to provide direction while not having direct authority <p> <li> <li> <p> Growth mindset and a curiosity to lean into the latest industry data and best practice <p> <li> <ul> <h3> <strong> Come change how the world works <strong> <h3> <p> At Upwork youll shape talent solutions for how the world works today We are a remotefirst organization working together to create exciting remote work opportunities for a global community of professionals While we have physical offices in San Francisco and Chicago currently we also support hiring of corporate fulltime employees in 19 states in the United States Please speak with a member of our recruitment team to determine whether you are located in a state in which we are hiring corporate fulltime employees <p> <p> At the core of our vibrant culture are shared values that form the foundation of our organization These values revolve around trust risktaking customer focus and excellence Our overarching mission is to create economic opportunities so that people have better lives We foster an environment where individuals are encouraged to bring their authentic selves to work nurturing personal and professional growth through development opportunities mentorship programs and participation in Upwork Belonging Communities <p> <p> We take pride in providing exceptional benefits to our employees These include comprehensive medical insurance coverage for both you and your family unlimited paid time off a 401k plan with matching contributions 12 weeks of paid parental leave and an Employee Stock Purchase Plan To explore these benefits in detail as well as gain insights into our company values working principles and the overall employee experience we invite you to visit our <a class=fontbold underline fontbold underline fontbold underline href=httpswwwupworkcomcareerslifeatupwork rel=noopener noreferrer nofollow target=blank> Life at Upwork page <a> <p> <p> Upwork is proudly committed to recruiting and retaining a diverse and inclusive workforce As an Equal Opportunity Employer we never discriminate based on race religion color national origin gender including pregnancy childbirth or related medical condition sexual orientation gender identity gender expression age status as a protected veteran status as an individual with a disability or other applicable legally protected characteristics <p> <p> LIRemote <p><p>

Senior Backend Engineer - Styles

Company: Webflow

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <p> At Webflow our mission is to bring development superpowers to everyone Webflow is the leading visual development platform for building powerful websites without writing code By combining modern web development technologies into one platform Webflow enables people to build websites visually saving engineering time while clean code seamlessly generates in the background From independent designers and creative agencies to Fortune 500 companies millions worldwide use Webflow to be more nimble creative and collaborative Its the web made better <p> <p> The Styles team is responsible for building and investing in the design capabilities of our core product to empower millions of designers worldwide to easily adopt Webflow to build manage and scale any number of sites efficiently <p> <p> Were looking for a Senior Backend Engineer to join the Styles team and lead the team to deliver impactful features for our customers to build highly personalized web experiences In this role you will execute the technical direction and be a mentor amp partner to other engineers on the team Additionally you will help lead crossfunctional efforts to drive even greater impact <p> <h2> <strong> About the role <strong> <h2> <ul> <li> <p> Location Remotefirst United States BC amp ON Canada <p> <li> <li> <p> Fulltime <p> <li> <li> <p> Permanent <p> <li> <li> <p> Exempt US Candidates <p> <li> <li> <p> Reporting to the Engineering Manager of Designer UX team <p> <li> <li> <p> The cash compensation for this role is tailored to align with the cost of labor in different geographic markets Weve structured the base pay ranges for this role into zones for our geographic markets and the specific base pay within the range will be determined by the candidates geographic location jobrelated experience knowledge qualifications and skills <p> <ul> <li> <p> Zone A $162500 $216050 <p> <li> <li> <p> Zone B $152700 $203100 <p> <li> <li> <p> Zone C $143000 $190150 <p> <li> <ul> <ul> <li> <p> CAD 184600 CAD 245500 <p> <li> <ul> <ul> <li> <p> United States all figures cited below in USD and pertain to workers in the United States <p> <li> <li> <p> Canada All figures cited below in CAD and pertain to workers in ON amp BC Canada <p> <li> <ul> <li> <ul> <p> Please visit our <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowaboutwebflowiocareers rel=noopener noreferrer nofollow target=blank> Careers page <a> for more information on which locations are included in each of our geographic pay zones However please confirm the zone for your specific location with your recruiter <p> <p> As a Senior Backend Engineer youll <p> <ul> <li> <p> Design and implement scalable backend services <p> <li> <li> <p> Drive crosspillar collaboration with software engineers product managers designers and QA analysts in an autonomous supportive team environment <p> <li> <li> <p> Effectively communicate team priorities and strategy to engineering and crossfunctional leadership teams <p> <li> <li> <p> Build and maintain unit and integration tests <p> <li> <li> <p> Provide clarity on processes and priorities to crosspillar partners and other engineers on the team <p> <li> <li> <p> Mentor other engineers on best practices code design considerations and quality <p> <li> <ul> <p> In addition to the responsibilities outlined above at Webflow we will support you in identifying where your interests and development opportunities lie and well help you incorporate them into your role <p> <h2> <strong> About you <strong> <h2> <p> Youll thrive as a Senior Backend Engineer Styles if you <p> <ul> <li> <p> Have 5+ years of experience in scalable multitenant environments <p> <li> <li> <p> Have 2+ years experience working with feature teams on customerfacing products shipping and iterating to solve customer problems <p> <li> <li> <p> Value testing and documentation equally as much as your code <p> <li> <li> <p> Are comfortable with ambiguity and scoping solutions with your teammates <p> <li> <li> <p> Are comfortable working on JavascriptTypescript MongoDB and Node <p> <li> <li> <p> Have consistently communicated trade offs throughout a project to meet both technical and business requirements <p> <li> <li> <p> Enjoy highvisibility work and presenting to executive counterparts <p> <li> <li> <p> Get excited about encouraging and developing other engineers <p> <li> <ul> <p> Even if you dont meet 100 of the above qualifications you should still seriously consider applying Research shows that you may still be considered for a role if you meet just half of the requirements <p> <p> <strong> Our Core Behaviors <strong> <p> <ul> <li> <p> <strong> Obsess over customer experience <strong> We deeply understand what were building and who were building for and serving We define the leading edge of whats possible in our industry and deliver the future for our customers <p> <li> <li> <p> <strong> Move with heartfelt urgency <strong> We have a healthy relationship with impatience channeling it thoughtfully to show up better and faster for our customers and for each other Time is the most limited thing we have and we make the most of every moment <p> <li> <li> <p> <strong> Say the hard thing with care <strong> Our best work often comes from intelligent debate critique and even difficult conversations We speak our minds and dont sugarcoat things and we do so with respect maturity and care <p> <li> <li> <p> <strong> Make your mark <strong> We seek out new and unique ways to create meaningful impact and we champion the same from our colleagues We work as a team to get the job done and we go out of our way to celebrate and reward those going above and beyond for our customers and our teammates <p> <li> <ul> <h3> <strong> Benefits amp wellness <strong> <h3> <ul> <li> <p> Equity ownership RSUs in a growing privatelyowned company <p> <li> <li> <p> 100 employerpaid healthcare vision and dental insurance coverage for employees and dependents fulltime employees working 30+ hours per week as well as Health Savings AccountHealth Reimbursement Account dependent care Flexible Spending Account US only dependent on insurance plan selection where applicable in the respective country of employment Employees may also have voluntary insurance options such as life disability hospital protection accident and critical illness where applicable in the respective country of employment <p> <li> <li> <p> 12 weeks of paid parental leave for both birthing and nonbirthing caregivers as well as an additional 68 weeks of pregnancy disability for birthing parents to be used before child bonding leave where local requirements are more generous employees receive the greater benefit Employees also have access to family planning care and reimbursement <p> <li> <li> <p> Flexible PTO with a mandatory annual minimum of 10 days paid time off for all locations where local requirements are more generous employees receive the greater benefit and sabbatical program <p> <li> <li> <p> Access to mental wellness and professional coaching therapy and Employee Assistance Program <p> <li> <li> <p> Monthly stipends to support health and wellness smart work and professional growth <p> <li> <li> <p> Professional career coaching internal learning amp development programs <p> <li> <li> <p> 401k plan and pension schemes in countries where statutorily required financial wellness benefits like CPA or financial advisor coverage <p> <li> <li> <p> Discounted Pet Insurance offering US only <p> <li> <li> <p> Commuter benefits for inoffice employees <p> <li> <ul> <p> <em> Temporary employees are not eligible for paid holiday time off accrued paid time off paid leaves of absence or companysponsored perks unless otherwise required by law <em> <p> <h3> <strong> Be you with us <strong> <h3> <p> At Webflow equality is a core tenet of our culture We are an Equal Opportunity EEOVeteransDisabled Employer and are <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomdiversityequityinclusion rel=noopener noreferrer nofollow target=blank> committed <a> to building an inclusive global team that represents a variety of backgrounds perspectives beliefs and experiences Employment decisions are made on the basis of jobrelated criteria without regard to race color religion sex sexual orientation gender identity national origin disability veteran status or any other classification protected by applicable law Pursuant to the San Francisco Fair Chance Ordinance Webflow will consider for employment qualified applicants with arrest and conviction records <p> <h3> <strong> Stay connected <strong> <h3> <p> Not ready to apply but want to be part of the Webflow community Consider following our story on our <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomblog rel=noopener noreferrer nofollow target=blank> Webflow Blog <a> <a class=fontbold underline fontbold underline fontbold underline href=httpswwwlinkedincomcompanywebflowinc rel=noopener noreferrer nofollow target=blank> LinkedIn <a> <a class=fontbold underline fontbold underline fontbold underline href=httpstwittercomwebflow rel=noopener noreferrer nofollow target=blank> X Twitter <a> andor <a class=fontbold underline fontbold underline fontbold underline href=httpswwwglassdoorcomReviewsWebflowReviewsE890506htm rel=noopener noreferrer nofollow target=blank> Glassdoor <a> <p> <h3> <strong> Please note <strong> <h3> <p> <em> We will ensure that individuals with disabilities are provided reasonable accommodation to participate in the job application or interview process to perform essential job functions and to receive other benefits and privileges of employment Upon interview scheduling instructions for confidential accommodation requests will be administered <em> <p> <p> <em> To join Webflow youll need a valid right to work authorization depending on the country of employment <em> <p> <p> <em> If you are extended an offer that offer may be contingent upon your successful completion of a background check which will be conducted in accordance with applicable laws We may obtain one or more background screening reports about you solely for employment purposes <em> <p> <p> <em> For information about how Webflow processes your personal information please review <em> <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomlegalapplicantprivacynotice rel=noopener noreferrer nofollow target=blank> <em> Webflows Applicant Privacy Notice <em> <a> <em> <em> <p><p>

Principal Engineer

Company: TeamSnap

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <p> <strong> 🌎 About Us <strong> <p> <p> At TeamSnap we believe when the world connects through sports the world becomes better TeamSnap is a sports and communication platform dedicated to taking the work out of play in youth sports We also believe our jobs should excite us our teammates should support us and our bosses should inspire us We empower our people to bring big ideas and tiny egos landing us on Outside Magazines list of <strong> Best Places to Work <strong> and Built Ins <strong> 100 Best RemoteFirst Places to Work <strong> <p> <p> <p> <p> TeamSnap is seeking a Principal Engineer who will report directly to the VP Engineering and Chief Architect to help define lead and drive our technological evolution As a technology leader youll shape our engineering culture in a positive direction with transparency and collaboration by mentoring leading and pairing with teams to evolve their practices and technical vision <p> <p> <p> <p> <p> <p> <strong> What youll be doing <strong> <p> <ul> <li> <p> Execute on the establishment of reference architecture and domain models <p> <li> <li> <p> Influence evolution of developer tooling and experience <p> <li> <li> <p> Help drive the definition of emerging technical and architectural strategies <p> <li> <li> <p> Supporting execution of critical projects via joining scrum teams as an additive team member ensuring the continuity of deliverables beyond scrum team interaction <p> <li> <li> <p> Ensure strong documentation of all systementerprise architecture as well as ancillary collateral such as sequence diagrams eventing orchestration layers and interoperability <p> <li> <li> <p> Define and own core KPIs to track the maintainability and effectiveness of our architecture and technology <p> <li> <li> <p> Encourage innovation creative thought and new ideassolutions <p> <li> <li> <p> Work with department leaders to identify shape and capture strategic technical work <p> <li> <li> <p> Being a strong partner and goto person for all engineering teams <p> <li> <li> <p> Contributing to engineeringwide goals priorities and improvements <p> <li> <li> <p> Consistently and systemically rallying inspiring and empowering all teams to do their best work ever <p> <li> <ul> <p> <p> <p> <strong> Whatll set you up for success <strong> <p> <ul> <li> <p> Experience leading and driving engineering departmentwide change during an evolutionary period of rapid growth and change while serving as a role model for an inclusive engineering culture <p> <li> <li> <p> Experience supporting both product and platform engineering teams as well as familiarity with our tech stack Google Cloud Platform Kubernetes Docker Terraform Datadog Elixir Typescript Golang <p> <li> <li> <p> Experience working across crossfunctional teams to foster a culture of priority setting and urgency in alignment with organizational strategy <p> <li> <li> <p> Deep experience in at least one of the following frontend web architecture mobile development platforms serverless and serverfull hybrid cloud architectures industryleading developer experience automation and tooling <p> <li> <li> <p> Youre comfortable working with nontechnical senior leaders and can convey complex technical topics to them in an approachable manner inviting collaborative discussion while also sweating and diving into the details whenever necessary getting your hands dirty and diving into code with any engineers across our department <p> <li> <li> <p> Ideally you have strong experience at Codenames we play every two weeks <p> <li> <ul> <p> <p> <p> <p> <p> Got cold feet If youre thinking you dont meet 100 of the above qualifications <strong> you should still seriously consider applying <strong> Were all humans with special talents that go beyond whats listed here <p> <p> <p> <p> <strong> Compensation <strong> <p> <p> Were committed to equitable compensation for all TeamSnappers The salary for this role starts at a minimum of $170000 inclusive of bonus and benefits Compensation is adjusted based on work experience skills certifications and geographic location Comp is highly competitive nationwide so please dont hesitate to apply <p> <p> <p> <p> <strong> 🖥 Location <strong> <p> <p> TeamSnap is a fully remote company so you need to be very comfortable working with people who arent in the same time zone as you We are always expanding but there is a small list of states we do not hire in including Alabama Alaska Delaware District of Columbia Hawaii Iowa Louisiana Mississippi Nebraska New Mexico Rhode Island South Dakota and West Virginia and while we love all parts of the world we can only hire permanent US residents at this time <p> <p> <p> <p> <strong> 🚀 Opportunities to Grow <strong> <p> <p> At TeamSnap we work hard to provide a culture of trust accountability inclusivity and boundless opportunities to grow along with the chance to make a lasting impact and have some fun while doing it <p> <p> <p> <p> <strong> 🎩 Total Rewards <strong> <p> <p> Were proud to be <a class=fontbold underline fontbold underline postingslink href=httpswwwinccommattgiventhisstartupceospolicyonworkingremotelyisgeniusanditsbasedonafamoustvshowhtml rel=noopener noreferrer nofollow target=blank> <strong> remotefirst <strong> <a> <strong> <strong> Weve been remote since 2009 long before COVID made it cool <p> <p> Unlimited PTO and paid parental leave for ALL parents not just primary or secondary <p> <p> 100 premium coverage of medicaldentalvision for you and your family <p> <p> 401K to help you invest for the future <p> <p> $1500 annual learning and development stipend <p> <p> Travel to fun locations for allcompany meetings and team events <p> <p> Generous home office allowance to set you up for success <p> <p> TeamSnap SWAG to our <a class=fontbold underline fontbold underline postingslink href=httpsteamlockersquadlockercomlockersteamsnap401580 rel=noopener noreferrer nofollow target=blank> store <a> upon starting and a $50 credit on every work anniversary thereafter <p> <p> A monthly stipend reimbursement for health amp wellness and so much more <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpsdocsgooglecompresentationd1oER8pxhc3zkKRDigScyXd6nQWVNFPV6HwATawDsGhukeditslide=idg22b26eb773f1392 rel=noopener noreferrer nofollow target=blank> TeamSnap Total Rewards <a> <p> <p> <p> <p> 🏆 <strong> Working at TeamSnap <strong> <p> <p> At TeamSnap youre not a culture fit youre a culture add Check out our <a class=fontbold underline fontbold underline postingslink href=httpswwwcanvacomdesignDAE4bjYNX4xtJEKWBDcTWpSARgrKMAoAviewutmcontent=DAE4bjYNX4amputmcampaign=designshareamputmmedium=linkamputmsource=publishsharelink1 rel=noopener noreferrer nofollow target=blank> <strong> Culture Playbook <strong> <a> and learn how we succeed at being remotefirst what makes our company so unique and how were inspired by our people our customers and our values <p> <p> <p> <p> <strong> 🧡 Inclusion and Diversity <strong> <p> <p> Creativity and innovation cant thrive when were cookiecutter images of each other Were quickly growing more diverse but theres always room for improvement We are committed to inclusion and diversity at TeamSnap and we hold ourselves accountable for building an environment where everyone feels valued If you need any disabilityrelated adaptation during the recruitment process just let us know We are an Equal Employment Opportunity Employer <p><p>

Account Executive (Manager/Director of Strategic Accounts)

Company: OfferFit

Location: USA

Posted Apr 30, 2024

<p class=jobDescription> <p> <strong> Position Overview <strong> <p> <p> Were currently looking for a driven Account Executive ManagerDirector of Strategic Accounts to join our team In this role youll be responsible for winning and growing business for OfferFit by owning new and existing senior customer relationships <p> <p> <strong> In particular you will <strong> <p> <ul> <li> <p> Working closely with our business development amp marketing teams to create leads <p> <li> <li> <p> Lead discussions with potential new OfferFit customers <p> <li> <li> <p> Work with current and future OfferFit customers to determine the highestimpact applications of our AIsolution <p> <li> <li> <p> Participate in OfferFit POV motion to ensure they progress successfully working closely with OfferFits technical Implementation team <p> <li> <li> <p> Build amp own relationships with senior leaders at OfferFits customer companies eg CMOs CIOs <p> <li> <li> <p> Communicate customer needs to OfferFits product amp marketing teams ensuring a customercentric product roadmap <p> <li> <ul> <p> <strong> Why is it great <strong> <p> <ul> <li> <p> Be the face of the company working alongside our customers to help them succeed <p> <li> <li> <p> Sell a product with strong productmarket fit the pain of manual experimentation is a real pain point for marketers leading to a high level of enthusiasm for our products <p> <li> <li> <p> Get strong support from leadership OfferFit prioritizes sales helping your team succeed will be a true priority for the CEO and other Sales leadership team members <p> <li> <li> <p> Lead the AI transformation happening in marketing technology today OfferFit is at the forefront so youll be in the middle of the action <p> <li> <li> <p> Join OfferFits fastpaced supportive and professional team We make sure all of our team members are empowered and receive great mentorship and coaching <p> <li> <ul> <p> <strong> Whos a fit <strong> <p> <ul> <li> <p> Executionfocused leader you can structure a plan align stakeholders and see it through to execution <p> <li> <li> <p> People person you build trustbased relationships with internal team members and external partners and combine empathy with a willingness to have direct challenging conversations <p> <li> <li> <p> Processdriven you can create scalable frameworks to optimize the success of business outcomes <p> <li> <li> <p> Entrepreneurial you take initiative work around obstacles and always seek creative ways to get to the next level <p> <li> <li> <p> Technology enthusiast you are passionate about new technologies and their potential to impact businessasusual <p> <li> <li> <p> Clear communicator you are able to express yourself clearly and persuasively both in writing and speech <p> <li> <li> <p> Sales expert you have a history of enterprise sales and are wellversed in SPIN selling amp MEDDPICC qualification methodology <p> <li> <ul> <p> The base salary range for this position in the United States is $81000$142000 per year plus eligibility for additional commissionbonus ranging $91000$162000 with an overall OTE of $172000$305000 ability to earn more based on sales goals Eligibility for an additional end of year performance bonus commissions when applicable andor equity options may be provided as part of the compensation package in addition to a full range of medical financial andor other benefits depending on the position offered For nonUS based candidates base pay and overall compensation packages will be adjusted based on location Applicants should apply via OfferFits internal or external careers site <p> <p> <strong> OfferFit Benefits and Perks <strong> <p> <ul> <li> <p> Generous PTO starting at 25 days PTO per year and Parental leave policy 12 weeks paid <p> <li> <li> <p> 100 remote work environment with flexible hours <p> <li> <li> <p> Quarterly gatherings where we meet in person in a different city to work together bond as a team and celebrate our progress <p> <li> <li> <p> Weekly team events lunch and learns trivia virtual escape rooms town hall and team health barometer meetings <p> <li> <li> <p> Ability to learn and develop from an experienced leadership team exAmazon McKinsey BCG and IBM among others who are focused on building a talented diverse and inclusive tea <p> <li> <li> <p> Dedication to building a strong culture eg team resource groups weekly recognitions major life event celebrations mental healthsustainability days off etc <p> <li> <li> <p> US Only Competitive benefits major medical vision dental and LTD and 401K matching program <p> <li> <ul><p>

Frequently Asked Questions

What are typical salary ranges for Award‑Winning Culture roles at different seniority levels?
Entry‑level Culture Analyst roles often range from $50,000 to $70,000. Mid‑level positions such as Culture Program Manager usually earn $80,000 to $110,000. Senior roles like Chief Diversity Officer or Inclusion Director command $140,000 to $200,000, while executive titles such as VP of Culture & Inclusion or Chief People Officer can earn $200,000 to $300,000, depending on company size and geography.
What skills and certifications are required for Award‑Winning Culture professionals?
Key skills include data‑driven decision making, stakeholder communication, program design, and change management. Proficiency in people analytics platforms (Tableau, Power BI), culture survey tools (Culture Amp, Officevibe), and project management software (Asana, Monday.com) is essential. Certifications that boost credibility are SHRM‑CP or SHRM‑SCP, PHR/SPHR, Certified Diversity Professional (CDP), Inclusion Certified Professional (ICP), and Certified People Analytics Professional (CPAP).
Is remote work available for Award‑Winning Culture positions?
Yes. Many companies, including Salesforce, Microsoft, and Atlassian, offer fully remote or hybrid options for culture‑focused roles. Remote positions typically require strong virtual facilitation skills, proficiency with collaboration tools (Slack, Teams, Miro), and the ability to drive engagement through digital platforms.
What career progression paths exist within the Award‑Winning Culture field?
A common trajectory starts with an HR Analyst or Culture Analyst, moves to a Culture Coordinator or Program Manager, then to a Director of Culture or Inclusion, and culminates in executive roles such as VP of Culture & Inclusion or Chief People Officer. Advancement often hinges on demonstrated impact measured through employee engagement scores, retention metrics, and successful ESG reporting.
What industry trends are shaping the future of Award‑Winning Culture roles?
AI‑driven culture analytics are enabling real‑time sentiment tracking. ESG reporting now requires integrated cultural metrics, pushing professionals to master data tools like Power BI and Tableau. Hybrid work models demand new engagement strategies, while mental‑health initiatives and micro‑learning platforms are becoming core components of employee experience programs.

Related Pages