Contract Jobs in USA
44,726 open positions · Updated daily
Looking for Contract jobs in USA? Browse our curated listings with transparent salary information to find the perfect Contract position in the USA area.
Sr. Technical Recruiter
Company: hims & hers
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <h3> <strong> About the Role <strong> <h3> <p> We are looking for a passionate and organized Remote Sr Technical Recruiter Contract to help us rapidly grow our Technical teams You will make a massive impact on the future of our company and wear many hats from building processes sourcing and closing candidates and working across various business functions Its an incredible time to join the Hims amp Hers team <p> <h3> <strong> You Will <strong> <h3> <ul> <li> <p> Manage full cycle recruiting process kickoff meetings with hiring managers sourcing candidate screens navigate interview loops facilitate panel debriefs offer stage and onboarding handoff <p> <li> <li> <p> Build a pipeline of talent by sourcing candidates across LinkedIn Recruiter internal referrals applicants and new channels <p> <li> <li> <p> Partner closely with leaders including executive leadership in the domains you support <p> <li> <li> <p> Meet weeklybi weekly with hiring managers to provide updates improve process and learn <p> <li> <li> <p> Use datadriven insights to improve recruiting efficiency and influence hiring decisions <p> <li> <li> <p> Obsess on exceptional candidate experience <p> <li> <li> <p> Cultivate a collaborative and constructive team environment exemplifying a lowego highhumility and partnershiporiented approach <p> <li> <ul> <h3> <strong> You Have <strong> <h3> <ul> <li> <p> 8+ years fullcycle technical recruiting for areas in Software Engineering Infrastructure Data and Analytics Product Management Data Science Machine learning and the Mobile domain <p> <li> <li> <p> 5+ years sourcing technical roles on LinkedIn Recruiter <p> <li> <li> <p> Interest to explore new places to source in addition to your goto channels <p> <li> <li> <p> Proven ability to work in a fastpaced environment and manage multiple requisitions simultaneously <p> <li> <li> <p> Experience with applicant tracking systems ATS and recruitment software Greenhouse <p> <li> <li> <p> Excellent communication and interpersonal skills with the ability to build rapport with candidates and hiring teams <p> <li> <ul> <h3> <strong> Our Tech Stack <strong> <h3> <ul> <li> <p> Frontend React React Native Typescript GraphQL <p> <li> <li> <p> Backend Java Kotlin Spring Boot SQL Python <p> <li> <li> <p> Automation Cypress Fastly Postman Javascript <p> <li> <li> <p> Monitoring Logging Datadog Elasticsearch Logstash Kibana <p> <li> <li> <p> Cloud AWS GCP <p> <li> <li> <p> CICD Jenkins CircleCi <p> <li> <li> <p> Database PostgreSQL DBT <p> <li> <li> <p> Containers Docker <p> <li> <ul> <p> <p> <p> <em> LIRemote <em> <p> <p> <p><p>
Research Associate - siRNA/Peptides + Antibody
Company: Vial
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> <strong> Who We Are <strong> <p> <p> <p> <p> Vial is a global techdriven CRO providing nextgeneration clinical trial management services The Vial CRO powers its drug discovery arm Battery Bio an AIpowered hyper scalable biotech Battery Bio harnesses Vials unique 90 lower cost structure to produce more affordable drug development with efficient streamlined clinical trials <p> <p> <p> <p> Our mission is to reimagine the drug discovery process to empower scientists to cure all human disease We have assembled a talented team of clinical operators chemists and innovative thinkers to achieve this vision <p> <p> <p> <p> Vial is a San Francisco Californiabased company founded by Simon Burns in October 2020 Since our founding we have become a fastgrowing company of 100+ employees with over $100 million in funding from esteemed investors including General Catalyst Box Group and Byers Capital <p> <p> <p> <p> Vial is rebuilding the infrastructure to advance research By deploying technology at every step we are creating a more efficient future for drug discovery <p> <p> <p> <p> <strong> What Youll Do <strong> <p> <p> Work in a structurebased computationally driven drug discovery paradigm <p> <p> Iteratively scale rethink and collaborate on a drug discovery engine that will scale to hundreds of programs <p> <p> Work on assay development and process development for Vials in house discovery efforts <p> <p> Research new modalities + new approaches and serve as a thought partner to the team <p> <p> Work with other scientists clinicians computational biologists project managers and external partners to accomplish our mission of curing diseases <p> <p> <p> <p> <strong> What Youll Bring <strong> <p> <p> 35 years of experience in Antibody discoveryprogram development or roles directly related to the Research amp Development of antibody programs <p> <p> Entrepreneurial mindset experience in startup environment preferred a plus <p> <p> Deeply analytical systems thinker focused on finding scalable solutions <p> <p> <p> <p> <p> <p> <p> <p> $90000 $110000 a year <p> <p> <strong> Why Youll Love Working At Vial <strong> <p> <p> <p> <p> <strong> We are innately curiosity <strong> We found our calling in clinical trials after learning the pain points directly It is our curiosity that propels us to keep building finding new challenges and fulfilling our vision of reimagining clinical trials <p> <p> <strong> We believe in autonomy <strong> Team members do their best work when given autonomy In order to make an impact on the scale of the Vial vision we built our culture to enable each Vial team member to feel ownership of their domain <p> <p> <strong> We take pride in building mastery <strong> We believe in building master in a craft Craftsmanship a pride in ones craft is key to prolonged engagement on a difficult challenge Vials culture is one of highly autonomous deeply focused experts working on an immensely hard problem together <p> <p> <strong> Our strength is moving fast and staying humble <strong> We believe that if we build a team that is intellectually honest that we stay nimble and keep an open mind to all solutions well be adaptive and solve the problems that face us at every turn <p> <p> <p> <p> <strong> Benefits <strong> <em> Not applicable to Contract or Temp Positions <em> <p> <p> Competitive Equity Compensation <p> <p> Comprehensive benefits package including Medical Dental and Vision insurance <p> <p> 401k or RRSP Plan with Company Matching after first 90 days of employment <p> <p> One time Remote Office Setup Stipend <p> <p> Paid Parental Leave <p> <p> RemoteFirst Flexible Work Schedule <p> <p> Unlimited Vacation <p> <p> <p><p>
Director - Corporate FP&A
Company: Icertis
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> With unmatched technology and categorydefining innovation Icertis pushes the boundaries of whats possible with contract lifecycle management CLM The AIpowered analystvalidated Icertis Contract Intelligence ICI platform turns contracts from static documents into strategic advantage by structuring and connecting the critical contract information that defines how an organization runs Today the worlds most iconic brands and disruptive innovators trust Icertis to fully realize the intent of their combined 10 million contracts worth more than $1 trillion in 40+ languages and 93 countries <p> <p> <p> <p> <strong> Who we are <strong> Icertis is the only contract intelligence platform companies trust to keep them out in front now and in the future Our unwavering commitment to contract intelligence is grounded in our FORTE valuesFairness Openness Respect Teamwork and Executionwhich guide all our interactions with employees customers partners and stakeholders Because in our mission to be the contract intelligence platform of the world we believe how we get there is as important as the destination <p> <p> <p> <p> As the Director of FPampA you will play a critical leadership role you will work closely with all of companys functional leaders and bring key market strategic and operational insights that will shape the direction of the company and accelerate its growth You will also play a key role in telling the companys financial story to investors <p> <p> <p> <p> The ideal candidate will have a proven trackrecord of driving business outcomes through keen financial insight and business modeling They will have the ability to create a 360degree financial picture of the business that reflects and influences the companys strategy and be excellent at communicating with senior leaders and executives They will be toolsavvy with experience in creating scalable data and reporting solutions that support a datadriven culture LIRS1 <p> <p> <p> <p> <p> <p> <strong> What you will do <strong> <p> <ul> <li> <p> Formulate a robust 360degree financial picture of the business complete with market insights and operational drivers <p> <li> <li> <p> Develop and maintain the 3year Strategic Planning Model and forecast <p> <li> <li> <p> Deliver Global PampL and cash flow forecasts <p> <li> <li> <p> Drive Annual Planning Process work cross functionally to build and maintain the Annual Financial Plan and Departmental Budgets <p> <li> <li> <p> Build and deliver Business Performance ReportingOperating dashboards <p> <li> <li> <p> Perform strategic business analysis as needed MampA Geo Expansion <p> <li> <li> <p> Prepare financial analyses as needed to help drive improvements in the business Current focus areas include market expansion opportunities competitive benchmarking analyses pricing and strategic financial optimization strategies <p> <li> <li> <p> Partner with Controller to enhance and accelerate the financial reporting process <p> <li> <li> <p> Identifies and implements system and process improvements to increase the efficiency and effectiveness of planning and reporting workflows <p> <li> <li> <p> Prepare communications to Board of Directors <p> <li> <li> <p> Drive investor presentations and supporting analysis <p> <li> <li> <p> Develop a deep understanding of the business metrics with an eye towards understanding the benefits and risks from a financial perspective and helping to manage key business drivers and desired outcomes <p> <li> <li> <p> Play a key role in preparation of critical public financial documents to support the IPO process including working with bankers and supporting the production of investor materials and SEC filings eg S1 <p> <li> <ul> <p> <p> <p> <strong> What you will bring <strong> <p> <ul> <li> <p> 12+ years of experience of working in direct strategic analysis support of all aspects of the business at all areas of the PampL <p> <li> <li> <p> MBACPA or equivalent experience preferred <p> <li> <li> <p> Demonstrated complex modeling experience this is a handson role and managers are expected to directly contribute and lead by example <p> <li> <li> <p> Highly analytical detailoriented with a commitment to creating a highquality product Naturally inquisitive and able to extract information from various sources to identify and understand the underlying issue Not afraid to question results <p> <li> <li> <p> Prior success working in a fastpaced entrepreneurial environment takes initiative and works independently <p> <li> <li> <p> Working knowledge of accounting principles required including revenue recognition amortization and accrual vs cash accounting Must have a general understanding of financial statements <p> <li> <li> <p> Must have exceptional written visual and spoken communication skills <p> <li> <li> <p> Experience in preparing and delivering executive board and investor level communications <p> <li> <li> <p> IPO experience is a plus <p> <li> <li> <p> Must have advanced Excel Netsuite and Powerpoint skills <p> <li> <li> <p> Experience implementing financial analysis and planning tools required <p> <li> <ul> <p> <p> <p> <p> <p> $146000 $219000 a year <p> <p> <em> Pay offered will vary based on jobrelated factors such as location experience training skills and abilities In addition to the base salary and annual bonus target and an equity component is included in the compensation package <em> <p> <p> <strong> What we offer <strong> <p> <p> We are committed to the health and wellbeing of all Icertians their families the communities they live in and our customers This commitment is represented in the Icertis Four Rings of Responsibility Take Care of Self Take Care of Family Take Care of Community and Take Care of Business in that order <p> <p> <p> <p> To support these commitments Icertis offers excellent health and welfare benefits a generous 401k match and a robust paid time off program Here are some of the other reasons <a class=fontbold underline fontbold underline postingslink href=httpswwwicertiscomcompanynewsicertisplacesfirstinwashingtons100bestcompaniestoworkfor rel=noopener noreferrer nofollow target=blank> Icertis Places First in Washingtons 100 Best Companies to Work For | Icertis <a> <p> <p> <p> <p> ● Equity RSUs and shared ownership in the company <p> <p> ● Flexible work environment <p> <p> ● Paid maternity and paternity leave <p> <p> ● 7 Days for Humanity 7 paid volunteer days <p> <p> ● Generous holidays including the 4th of July week off paid <p> <p> ● Free professional and leadership coaching <p> <p> ● Annual personal development allowance <p> <p> <p> <p> Icertis Inc provides Equal Employment Opportunity to all employees and applicants for employment without regard to race color religion gender identity or expression sex sexual orientation national origin age disability genetic information marital status amnesty or status as a covered veteran in accordance with applicable federal state and local laws Icertis Inc complies with applicable state and local laws governing nondiscrimination in employment in every location in which the company has facilities If you are in need of accommodation or special assistance to navigate our website or to complete your application please send an email with your request to <a class=fontbold underline fontbold underline postingslink href=mailtocareersicertiscom rel=noopener noreferrer nofollow target=blank> careersicertiscom <a> or get in touch with your recruiter <p> <p> <p> <p> By submitting your application you acknowledge that you have read Icertiss Privacy Policy <a class=fontbold underline fontbold underline postingslink href=httpswwwicertiscomprivacystatement rel=noopener noreferrer nofollow target=blank> httpswwwicertiscomprivacystatement <a> <p> <p> <p> <p> Icertis is not open to third party solicitation or resumes for our posted FTE positions Resumes received from third party agencies that are unsolicited will be considered complimentary <p><p>
Commercial Contracts Administrator
Company: Twilio
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <h1> <strong> See yourself at Twilio <strong> <h1> <p> Join the team as our next Commercial Contracts Administrator <p> <h1> <strong> Who we are amp why were hiring <strong> <h1> <p> Twilio powers realtime business communications and data solutions that help <a class=fontbold underline fontbold underline fontbold underline href=httpscustomerstwiliocom rel=noopener noreferrer nofollow target=blank> companies and developers worldwide <a> build better applications and customer experiences <p> <p> Although were headquartered in San Francisco were on a journey to becoming a globally antiracist company that supports <a class=fontbold underline fontbold underline fontbold underline href=httpswwwtwiliocomcompanydiversity rel=noopener noreferrer nofollow target=blank> diversity equity amp inclusion <a> wherever we do business We employ thousands of Twilions worldwide and were looking for more builders creators and visionaries to help fuel our growth momentum <p> <h1> <strong> About the job <strong> <h1> <p> We are looking for a Commercial Contracts Administrator to join our Commercial Legal Strategy amp Operations function supporting the GoToMarket GTM sales and partners organization and Telecom Carrier Relations organization In this role you be a member of our Center of Excellence function which currently consists of three Contracts professionals The Center of Excellence serves as the first legal point of contact for all incoming GTM and Telecom Carrier Relations commercial legal support requests You will also directly support Twilios Commercial Legal team by reviewing and vetting requests for legal support on all commercial contractsrelated matters negotiating NDAs and drafting order forms <p> <h1> <strong> Responsibilities <strong> <h1> <p> In this role youll <p> <ul> <li> <p> Serve as a first point of contact to provide commercial contractsrelated education and process guidance to your GTM and Telecom Carrier Relations colleagues <p> <li> <li> <p> Review vet and provide timely responses to a high volume of incoming requests for legal support on general inquiries agreement negotiation requests and completion of miscellaneous documents eg RFPs vendor forms customer questionnaires while ensuring adherence to contract processes and policies <p> <li> <li> <p> Independently negotiate NDAs on Twilios template and counterpartys template <p> <li> <li> <p> Draft nonstandard contractual terms and language from scratch into order forms <p> <li> <li> <p> Be an operational expert on Twilios GTMfacing and telecom carrierfacing contracting processes <p> <li> <li> <p> Contribute to your knowledge and learnings from novel situations to the Center of Excellence Playbook <p> <li> <li> <p> Provide support on a variety of adhoc operational projects and tasks <p> <li> <ul> <h1> <strong> Qualifications <strong> <h1> <p> Not all applicants will have skills that match a job description exactly Twilio values diverse experiences in other industries and we encourage everyone who meets the required qualifications to apply While having desired qualifications make for a strong candidate we encourage applicants with alternative experiences to also apply If your career is just starting or hasnt followed a traditional path dont let that stop you from considering Twilio We are always looking for people who will bring something new to the table <p> <p> <strong> Required <strong> <p> <ul> <li> <p> A bachelors degree <p> <li> <li> <p> 3+ years of experience as a Contracts Coordinator Contracts Administrator or Contracts Paralegal which includes exposure drafting and negotiating NDAs and order forms <p> <li> <li> <p> Experience using commercial contracting tools including Salesforce Conga Microsoft Office Suite Google Suite DocuSign and Adobe Acrobat Pro <p> <li> <li> <p> Outstanding communication skills both written and verbal and strong attention to detail with a customerfirst attitude <p> <li> <li> <p> Be a processminded and oriented professional <p> <li> <li> <p> Ability to work in a fastpaced and everchanging environment with minimal supervision <p> <li> <ul> <p> <strong> Desired <strong> <p> <ul> <li> <p> Experience supporting a sales organization at a high growth technology company <p> <li> <li> <p> Experience creating and managing process documentation and policies <p> <li> <li> <p> Good sense of humor disdain for drama interest for learning new things and desire to get things done <p> <li> <ul> <p> <strong> Location <strong> <p> <p> This role can be located remotely and can be anywhere in the United States <p> <p> Approximately 10 of travel is expected <p> <h1> <strong> What We Offer <strong> <h1> <p> There are many benefits to working at Twilio including in addition to competitive pay things like generous timeoff ample parental and wellness leave healthcare a retirement savings program and much more Offerings vary by location <p> <h1> <strong> Twilio thinks big Do you <strong> <h1> <p> We like to solve problems take initiative pitch in when needed and are always up for trying new things Thats why we seek out colleagues who embody our values something we call <a class=fontbold underline fontbold underline fontbold underline href=httpswwwtwiliocomcompanyvalues rel=noopener noreferrer nofollow target=blank> Twilio Magic <a> Additionally we empower employees to build <a class=fontbold underline fontbold underline fontbold underline href=httpswwwtwilioorgimpactfund rel=noopener noreferrer nofollow target=blank> positive change in their communities <a> by supporting their volunteering and donation efforts <p> <p> So if youre ready to unleash your full potential do your best work and be the best version of yourself apply now <p> <p> If this role isnt what youre looking for <a class=fontbold underline fontbold underline fontbold underline href=httpswwwtwiliocomcompanyjobsopenpositions rel=noopener noreferrer nofollow target=blank> please consider other open positions <a> <p> <p> The estimated pay ranges for this role are as follows <p> <ul> <li> <p> Based in Colorado $69600 $87000 <p> <li> <li> <p> Based in New York Washington State or California outside the San Francisco Bay Area $73760 $92200 <p> <li> <li> <p> Based in the San Francisco Bay area California $81920 $102400 <p> <li> <li> <p> This role may be eligible to participate in Twilios equity plan All roles are eligible for the following benefits health care insurance 401k retirement account paid sick time paid personal time off paid parental leave <p> <li> <ul> <p> The successful candidates starting salary will be determined based on permissible nondiscriminatory factors such as skills experience and geographic location within the state <p> <p> <strong> Twilio is proud to be an equal opportunity employer <strong> Twilio is proud to be an Equal Employment Opportunity and Affirmative Action employer We do not discriminate based upon race religion color national origin sex including pregnancy childbirth reproductive health decisions or related medical conditions sexual orientation gender identity gender expression age status as a protected veteran status as an individual with a disability genetic information political views or activity or other applicable legally protected characteristics We also consider qualified applicants with criminal histories consistent with applicable federal state and local law Additionally Twilio participates in the EVerify program in certain locations as required by law <p> <p> Twilio is committed to providing reasonable accommodations for qualified individuals with disabilities and disabled veterans in our job application procedures If you need assistance or an accommodation due to a disability please contact us at accommodationtwiliocom <p><p>
Product Manager
Company: Agiloft, Inc
Location: USA
Posted Apr 30, 2024
Agiloft, a leading data-first agreements platform, has been named a Leader in the 2023 Gartner Magic Quadrant for Contract Life Cycle Management for the fourth consecutive year. The company's CLM platform has won numerous awards and is recognized for its pre-built applications, no-code platform, and AI-driven solutions. The Product Manager role involves understanding customer needs, driving solution development, and collaborating with cross-functional teams. The ideal candidate should have 3+ years of relevant experience, a technical degree, and strong storytelling skills.
New Business Senior Account Executive
Company: Twilio
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> <strong> <em> Because you belong at Twilio <em> <strong> <p> <h1> <strong> See yourself at Twilio <strong> <h1> <p> Join the team as our next New Business Senior Account Executive <p> <h1> <strong> Who we are amp why were hiring <strong> <h1> <p> Twilio powers realtime business communications and data solutions that help <a class=fontbold underline fontbold underline fontbold underline href=httpscustomerstwiliocom rel=noopener noreferrer nofollow target=blank> companies and developers worldwide <a> build better applications and customer experiences <p> <h3> <h3> <p> Although were headquartered in San Francisco we have presence throughout South America Europe Asia and Australia Were on a journey to becoming a global company that actively opposes racism and all forms of oppression and bias At Twilio we support <a class=fontbold underline fontbold underline fontbold underline href=httpswwwtwiliocomcompanydiversity rel=noopener noreferrer nofollow target=blank> diversity equity amp inclusion <a> wherever we do business <p> <h1> <strong> About the job <strong> <h1> <p> As a New Business Senior Account Executive you will be responsible for prospecting solution selling and closing new business opportunities across our Messaging Voice Email and Account Security products In this role you will be directly responsible for landing and expanding our messaging business with some of the largest and fastest growing enterprise companies spanning industries such as travel financial services insurance banking logistics retail and ecommerce New Business Senior Account Executives are experts in the CPaaS ecosystem and Twilios product offerings This role is highly cross functional with deep integration with product management field marketing and solutions engineering teams <p> <h1> <strong> Responsibilities <strong> <h1> <p> In this role you will <p> <ul> <li> <p> Be responsible for new customer acquisition while being assigned a quota for iACV incremental Account Contract Value <p> <li> <ul> <ul> <li> <p> Own highly analytical and consultative sales cycles to win business in competitive vendor sourcing cycles with Twilios industry leading messaging voice email and account security solutions <p> <li> <li> <p> Ability to multithread Enterprise accounts and comfortable building trusted relationships at all levels of buyers and influencers from the DeveloperProduct Manager to the CSuite <p> <li> <li> <p> Work with customers across assigned verticals to understand their business and technical requirements and match them to the capabilities of Twilios communications API platform designing a solution for their specific use cases <p> <li> <li> <p> Work with teams in Finance Legal Pricing Product and Operations to design mutually beneficial contracts to address customer requirements while balancing the needs of our business <p> <li> <li> <p> Be passionate about what you do think outside the box and use worldclass interpersonal and communication skills to present complex contractual technical and financial details to prospects in a way that builds confidence and comfort in the proposed solution <p> <li> <li> <p> Balance competing priorities and manage multiple projects and deals at the same time <p> <li> <li> <p> Partner cross functionally with sales services product marketing and ISV team to develop long range territory strategies and sales plans <p> <li> <li> <p> Act as the voice of the customer to Twilios product and carrier relations teams <p> <li> <li> <p> Establish yourself as a subject matter expert in the CPaaS industry staying up to date on key industry initiatives and new capabilities sharing your knowledge with your customers and the wider Twilio gotomarket organization <p> <li> <li> <p> Establish yourself as a subject matter expert in the vertical industries you are focused on This would include understanding industry regulatory requirements macroeconomic trends competitive environment digital initiative trends and ecosystem solution partners <p> <li> <li> <p> Ability to crisply articulate the power of CPaaS and how it is benefitting other vertical industry clients <p> <li> <li> <p> Generate and maintain an accurate pipeline and forecast utilizing our CRM Salesforce <p> <li> <ul> <h1> <strong> Qualifications <strong> <h1> <h3> <h3> <p> Not all applicants will have skills that match a job description exactly Twilio values diverse experiences in other industries and we encourage everyone who meets the required qualifications to apply While having desired qualifications make for a strong candidate we encourage applicants with alternative experiences to also apply If your career is just starting or hasnt followed a traditional path dont let that stop you from considering Twilio We are always looking for people who will bring something new to the table <p> <p> <strong> Required <strong> <p> <p> Demonstrated track record of selling and closing in the cloud communications platform market Specific requirements <p> <ul> <li> <p> Possess a total of 12 years of full cycle sales experience with a minimum of 5 years managing or leading quantitative highly analytical products or solutions for their customers <p> <li> <li> <p> Directly selling technical SaaS or CPaaS <p> <li> <li> <p> Experience outbound prospecting into install base greenfield prospecting into new accounts and executing strong QBR strategy for territory penetration <p> <li> <li> <p> Technical solutions selling experience working with real customers listening to them and solving problems <p> <li> <li> <p> Comfortable working with both line of business and highly technical leaders while influencing their understanding and building supportive partnerships across the organization <p> <li> <li> <p> Analytical account development strategy based on using data to find opportunities and prove value <p> <li> <li> <p> Demonstrated track record of managing business forecasts and financial models <p> <li> <li> <p> Entrepreneurial mindset with appetite to define process and build programs <p> <li> <li> <p> Record of delivering market driven results especially to scale and enterprise customers <p> <li> <li> <p> Excellent verbal and written communication skills English <p> <li> <li> <p> Bachelors Degree or equivalent years of experience <p> <li> <ul> <h3> <h3> <p> <strong> Desired <strong> <p> <ul> <li> <p> Deep experience working in CPAAS or global communications platforms <p> <li> <li> <p> Domain expertise from a highly quantitative industry such as Retail eCommerce DevOps Fintech Insurance advertising optimization banking or security or Software SaaS CPaas or PaaS selling experience <p> <li> <ul> <h3> <h3> <p> <strong> Location <strong> <p> <p> This role will be remote and based in the USA <p> <h3> <h3> <p> <strong> Travel <strong> <p> <h3> <h3> <p> We prioritize connection and opportunities to build relationships with our customers and each other For this role approximately 3040 travel is anticipated to help you connect inperson in a meaningful way <p> <h1> <strong> What We Offer <strong> <h1> <p> There are many benefits to working at Twilio including in addition to competitive pay things like generous timeoff ample parental and wellness leave healthcare a retirement savings program and much more Offerings vary by location <p> <h1> <strong> Twilio thinks big Do you <strong> <h1> <p> We like to solve problems take initiative pitch in when needed and are always up for trying new things Thats why we seek out colleagues who embody our values something we call <a class=fontbold underline fontbold underline fontbold underline href=httpswwwtwiliocomcompanyvalues rel=noopener noreferrer nofollow target=blank> Twilio Magic <a> Additionally we empower employees to build <a class=fontbold underline fontbold underline fontbold underline href=httpstwilioorgimpact2021report rel=noopener noreferrer nofollow target=blank> positive change in their communities <a> by supporting their volunteering and donation efforts <p> <p> So if youre ready to unleash your full potential do your best work and be the best version of yourself apply now <p> <p> If this role isnt what youre looking for <a class=fontbold underline fontbold underline fontbold underline href=httpswwwtwiliocomcompanyjobsopenpositions rel=noopener noreferrer nofollow target=blank> please consider other open positions <a> <p> <p> <em> Please note this role is open to candidates outside of Colorado California New York and Washington The information below is provided for candidates hired in those locations only <em> <p> <p> The estimated pay ranges for this role are as follows <p> <ul> <li> <p> Based in Colorado $120600 $15075000 <p> <li> <li> <p> Based in New York Washington State or the San Francisco Bay area California $134000 $167500 <p> <li> <li> <p> This role may be eligible to participate in Twilios equity plan All roles are eligible for the following benefits health care insurance 401k retirement account paid sick time paid personal time off paid parental leave <p> <li> <li> <p> This role is eligible to earn commissions <p> <li> <ul> <p> The successful candidates starting salary will be determined based on permissible nondiscriminatory factors such as skills experience and geographic location within the state <p> <p> <strong> Twilio is proud to be an equal opportunity employer <strong> Twilio is proud to be an Equal Employment Opportunity and Affirmative Action employer We do not discriminate based upon race religion color national origin sex including pregnancy childbirth reproductive health decisions or related medical conditions sexual orientation gender identity gender expression age status as a protected veteran status as an individual with a disability genetic information political views or activity or other applicable legally protected characteristics We also consider qualified applicants with criminal histories consistent with applicable federal state and local law Additionally Twilio participates in the EVerify program in certain locations as required by law <p> <p> Twilio is committed to providing reasonable accommodations for qualified individuals with disabilities and disabled veterans in our job application procedures If you need assistance or an accommodation due to a disability please contact us at accommodationtwiliocom <p><p>
Senior Software Engineer - Ruby on Rails, Backend
Company: Synack
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> At Synack we create technology that unleashes the best cybersecurity talent to secure our digital world <p> <p> We protect leading global organizations by reducing companies security risk and increasing their resistance to cyber attack How do we do this By utilizing the worlds best and most trusted team of ethical hackers who test through our powerful and controlled platform to deliver real security without compromise <p> <p> Backed by toptier venture capital firms including Kleiner Perkins Caufield amp Byers Microsoft and Google Ventures Synacks mission is to leverage global security talent coupled with advanced technology to help enterprises discover security vulnerabilities before they become business problems Discover the possibilities at Synack <p> <p> Are you ready to leverage your software development skills to build a platform that is transforming cybersecurity As a Senior Software Engineer Ruby on Rails Backend you will be part of a fastpaced collaborative team developing our cybersecurity platforms You will be a critical contributor to the development of the system while implementing engineering best practices If you enjoy pivoting between different problems and meeting new challenges every day while developing a solution that is mission critical to the organization this role is for you Sounds interesting Keep reading <p> <p> <strong> Please note <strong> This is a remote position based in the US We can only hire US citizens for this position due to federal government contract requirements <p> <p> <p> <p> <strong> Heres what youll do <strong> <p> <ul> <li> <p> Design develop and maintain highly scalable and available microservices hosted on Google Cloud Platform and Azure <p> <li> <li> <p> Collaborate with the product team and engineering leadership in requirements gathering planning and estimation <p> <li> <li> <p> Architect and implement business logic in Ruby on Rails backend and Relational data store <p> <li> <li> <p> Develop and evolve APIs to interface with Web UI <p> <li> <li> <p> Write clean maintainable and efficient code following our coding standards <p> <li> <li> <p> Identify and resolve performance bottlenecks bugs and backend issues <p> <li> <li> <p> Participate in system design code reviews and production releases <p> <li> <li> <p> Contribute to our technical documentation and update system and data flow diagrams as you introduce new features <p> <li> <ul> <p> <strong> Heres what youll need <strong> <p> <ul> <li> <p> 8+ years designing and building dynamic production solutions <p> <li> <li> <p> Solid understanding of objectoriented programming <p> <li> <li> <p> 8+ years in a Ruby on Rails <p> <li> <li> <p> 2+ years experience with building and deploying containerized applications K8s is a bonus <p> <li> <li> <p> Solid backend experience with background jobs processors such as SideKiq <p> <li> <li> <p> Experience with queue and messaging solutions such as PubSubKafka <p> <li> <li> <p> Experience designing and building RESTful APIs <p> <li> <li> <p> Experience with testing tools such as Rspec Jest TestCafe React Testing Library <p> <li> <li> <p> Understanding of various database systems such as RDBMS and NOSQL <p> <li> <li> <p> Experience working with cloud hosted environments <p> <li> <ul> <p> <strong> Great to have <strong> <p> <ul> <li> <p> 2+ years using ReactJSRedux or other JavaScript frameworks and libraries <p> <li> <li> <p> 2+ years of experience with Golang <p> <li> <li> <p> Experience with GCP <p> <li> <li> <p> Experience working in Cyber security problem space <p> <li> <ul> <p> <strong> Ready to join us <strong> <p> <p> Synack is committed to embracing diversity Our people are our strength Each addition to our team is an opportunity to grow and diversify our ideas experiences and viewpoints We strive to be inclusive of Race Ethnicity Religion Sex LGBTQ+ Veterans Disabilities and Age Synack welcomes you <p> <p> As a candidate Synack cares about your privacy Please view our candidate privacy policy <a class=fontbold underline fontbold underline fontbold underline href=httpswwwsynackcomcandidateprivacynotice rel=noopener noreferrer nofollow target=blank> here <a> <p> <p> <strong> $115000 $230000 py <strong> Salary is determined by a combination of factors including location level relevant experience and skills The range displayed on each job posting reflects the minimum and maximum target for new hire salaries for the position across all US locations The compensation package for this position may also include equity and benefits For more details about our benefits please see <a class=fontbold underline fontbold underline fontbold underline href=httpssynackmybenefitslife rel=noopener noreferrer nofollow target=blank> here <a> Then for the Employer code enter <strong> synack <strong> <p><p>
Procurement Engineer (Mechanical Commodity)
Company: Qcells
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> Hanwha Q CELLS USA Corp HQC US develops invests and delivers solar photovoltaic PV and battery energy storage systems BESS projects through Engineering Procurement Construction EPC services in North America <p> <p> <p> <p> The company brings a decade of global leadership in solar PV to deliver utilityscale power generation plants customized for local and regional energy markets HQC US offers the full spectrum of PV solutions from the core technology of cells and modules to largescale project development and investment With proven capabilities across the solar and battery storage value chain HQC US minimizes uncertainty and risk and helps customers achieve a higher return on their investment in renewable energy <p> <p> <p> <p> <strong> SUMMARY <strong> <p> <p> The Procurement Engineer will serve as the lead technical representative for the Procurement <p> <p> organization for their assigned commodities They will be responsible for performing the purchase process for major equipment racking foundation piles etc from RFP to purchase ordercontract execution in conjunction with other members of the team Additional responsibilities will include identifying and assessing new vendors and emerging technologies maintaining a database of current suppliers supporting the prequalification process and monitoring supplier performance Works closely with key suppliers that support the overall strategic objectives of the organization and ensure reliable support and supply of materials to projects May be assigned other tasks as needed This position reports to the Procurement Manager or another management personnel that the President of the Company may designate This position is remote eligible with required travel to Qcells HQ in Irvine CA and other locations as needed Working hours are Monday through Friday from 800am to 500pm or 900am to 600pm local time This position is expected to travel up to 15 <p> <p> <p> <p> <p> <p> <p> <p> <strong> ESSENTIAL JOB FUNCTION amp RESPONSIBILITIES <strong> <p> <ul> <li> <p> Regular attendance in accordance with companys attendance policy and supervisory assignment is an essential job duty requirement for this position and <p> <li> <li> <p> Collaborate with internal and external stakeholders to optimize the procurement of materials andor services <p> <li> <li> <p> Manage key procurement processes in alignment with Companies overall strategic goals <p> <li> <li> <p> Explore new technologies lead the evaluation and benchmarking of new products to determine the potential financial and performance value of the products and potential impacts if implemented <p> <li> <li> <p> Act as liaison between Procurement and vendor and internal engineering teams <p> <li> <li> <p> Administers the RFP process including but not limited to the following <p> <li> <li> <p> Prepare RFPs to qualified suppliers including working with other functional groups to gather all required documents and data <p> <li> <li> <p> Determine and maintain bid schedules in accordance with project schedules <p> <li> <li> <p> Coordinate responses to RFIs from bidders <p> <li> <li> <p> Review compare and evaluate supplier proposals with historical and market pricing to determine costcompetitive pricing and identify opportunities for cost savings <p> <li> <li> <p> Support commercial negotiations for Equipment Supply Agreements project specific orders change orders etc with key suppliers in accordance with company policies and guidelines <p> <li> <li> <p> Administer change order process for suppliers and other related contract management processes <p> <li> <li> <p> Ensure prime contract flow downs are incorporated into subcontract documents as needed or applicable to scope of worksupply <p> <li> <li> <p> Monitor supplier compliance to contract terms and project requirements <p> <li> <li> <p> Support Project Management and Operations teams as needed with contract information and input to resolve supplier issues such as underperformance or scope gaps <p> <li> <li> <p> Evaluate vendor performance and develop improvement processes based on lessons learned <p> <li> <li> <p> Evaluate vendor products systems and structure for quality and performance <p> <li> <li> <p> Ensure compliance with industry standards best practices and requirements <p> <li> <li> <p> Support Project Management Team as needed with urgent procurement needs <p> <li> <li> <p> Maintain accurate and complete purchasing records in accordance with record retention procedures <p> <li> <li> <p> Support qualification and onboard new vendors and <p> <li> <li> <p> Perform other duties and special projects as assigned by Management <p> <li> <ul> <p> <p> <p> <strong> REQUIRED QUALIFICATIONS <strong> <p> <ul> <li> <p> Requires BS degree in Mechanical or Civil Engineering <p> <li> <li> <p> 35 years of prior relevant experience or equivalent combination of education and directly related experience General knowledge of supply chain management and procurement as well as construction principles and processes <p> <li> <li> <p> Minimum 2 years of experience in solar andor construction field project at the project size of over $30M in procurement of equipmentmaterial or subcontracting <p> <li> <li> <p> Experience in Solar or Renewable Energy <p> <li> <li> <p> Knowledge of major mechanical equipment used in the construction of renewable energy facilities fixed tilt racking systems tracker systems foundation piles etc <p> <li> <li> <p> Ability to read and interpret drawings and specifications <p> <li> <li> <p> Knowledge of negotiated bids lump sum and DesignBuild processes preferred <p> <li> <li> <p> Working knowledge of PVSyst AutoCAD Microsoft 365 suite Bluebeam etc <p> <li> <li> <p> Strong math and analytical skills <p> <li> <li> <p> Knowledge of contract management <p> <li> <li> <p> Ability to work autonomously in a fast pace professional team environment with minimal supervision <p> <li> <li> <p> Ability to prioritize tasks appropriately and in support of project schedules and other deadlines <p> <li> <li> <p> Excellent organizational skills and attention to detail <p> <li> <li> <p> Strong verbal and written communication skills <p> <li> <li> <p> Confidence communicator and ability to interact with people at all levels of the organization <p> <li> <li> <p> Experience in conducting supplier reviews and evaluation and maintaining good business relationships <p> <li> <li> <p> Strong understanding of construction management software systems Procore preferred <p> <li> <li> <p> SAP Experience preferred <p> <li> <ul> <p> <p> <p> <p> <p> The abovelisted salary range is required by the California Pay Transparency Act and may differ depending on the location of those candidates hired nationwide The salary range shared in the job description is for the listed position and only pertains to the candidate if they work in Irvine CA Actual compensation is influenced by a wide array of factors including but not limited to internal pay equity skill set education licenses and certifications geographic location essential job duties and requirements and the necessary experience relative to the jobs minimum qualifications An additional discretionary bonus structure or incentives may be offered as part of the overall compensation package in addition to the full range of medical dental andor other benefits dependent on the level and position offered <p> <p> <p> <p> <strong> PHYSICAL DEMANDS <strong> <p> <p> <strong> <strong> <p> <p> Stationary Position frequently remains stationary up to 90 of the time and sitting up to 8 hours in a day <p> <p> MoveTraverse infrequently bend stand stoop andor walk <p> <p> Carry Weight infrequently carry weight andor lift objects light to heavy weighing up to 10 pounds <p> <p> Hearing and Speech frequently communicates with the ability to hear and talk on a regular basis with employees coworkers and all personnel matters must be able to exchange accurate information in these situations <p> <p> Sight frequent use of sight to detect images on computer office documents and office objects near and far <p> <p> Climb occasionally ascendsdescends on stairway to get to office upper and lower floors <p> <p> Travel review above travel requirement for this position <p> <p> <p> <p> <strong> WORK ENVIRONMENT <strong> <p> <p> <strong> <strong> <p> <p> Regular professional office business setting <p> <p> Noise level ranges from low to moderate if in office setting <p> <p> Noise level ranges from moderate to high if on construction worksite <p> <p> <p> <p> <em> Hanwha Q Cells is proud to be an atwill Equal Opportunity Employer and prohibits discrimination against race color religion sex sexual orientation gender perception or identity national origin age marital status pregnancy citizenship disability protected veteran status and any other classification protected by applicable federal state or local law This policy applies to all terms and conditions of employment including recruiting hiring placement promotion termination layoff recall transfer leaves of absence compensation and training <em> <p> <p> <em> <em> <p> <p> <em> We are committed to the full inclusion of all qualified individuals As part of this commitment Hanwha Q Cells will provide reasonable accommodations to all qualified individuals with disabilities to participate in the job application or interview process to perform essential job functions andor to receive other benefits and privileges of employment Please contact us to request accommodations at <em> <a class=fontbold underline fontbold underline postingslink href=mailtohrusaqcellscom rel=noopener noreferrer nofollow target=blank> <em> hrusaqcellscom <em> <a> <em> <em> <p> <p> <em> <em> <p> <p> <em> Nothing in this statement shall imply implicitly or explicitly a guarantee of employment outside our atwill employment opportunity <em> <p> <p> <p> <p> You may view your privacy rights by reviewing Qcells <a class=fontbold underline fontbold underline postingslink href=httpshqamericasboxcomsyox07qmkqxc5o1rw77oqb32459v9pn76 rel=noopener noreferrer nofollow target=blank> Privacy Policy here <a> or contacting our <a class=fontbold underline fontbold underline postingslink href=mailtohruseqcellscom rel=noopener noreferrer nofollow target=blank> HR Team <a> for a copy <p><p>
Governance Development
Company: Gauntlet
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> Gauntlet leads the field in quantitative research and optimization of DeFi economics We manage market risk optimize growth and ensure economic safety for protocols facilitating the majority of spot trading borrowing and lending activity across all of DeFi protecting and optimizing the largest protocols and networks in the industry As of January 2024 Gauntlet manages risk and incentives covering over $13 billion in customer TVL <p> <p> <p> <p> Gauntlet continually publishes cuttingedge research that informs our risk models alerts and analysis and is among the most cited institution including academic institutions in terms of peerreviewed papers addressing DeFi as a subject Were a Series B company with around 60 employees operating remotefirst with a home base in New York City <p> <p> <p> <p> Gauntlets mission is to <strong> drive adoption and understanding in the financial systems of the future <strong> Building with decentralized systems creates novel challenges for mechanism designers smart contract developers and endusers of financial products which are not seen in traditional software development and investing contexts Gauntlet is dedicated to enhancing our industrys understanding of this new domain and revealing how to safely navigate the true bleeding edge of 21st century financial innovation <p> <p> <p> <p> Our extremely passionate team works tirelessly to bridge the gap for datadriven insights and analytical research in collateralized blockchain protocols We strive to maintain an atmosphere that fosters innovation and new ideas through collaboration research and deep discussion to meet our customers needs to grow and manage incentives better <p> <p> <p> <p> In order to grow our impact in the DeFi space we are looking to hire an experienced cryptonative Governance actor to support Gauntlets increasing delegate activities This role will be an active participant in the DAOs where Gauntlet is a delegate ongoing forum participation maintaining exemplary voting and communication rates and joining delegate calls or other DAOrelated events among other things This role will also actively seek out opportunities for new delegation and proactively identify potential revenue opportunities that align with Gauntlets business <p> <p> <p> <p> <p> <p> <strong> Responsibilities <strong> <p> <ul> <li> <p> Develop an intricate understanding of the DAOs where Gauntlet is or becomes a delegate <p> <li> <li> <p> Active forum participation commenting on proposals and other DAOwide conversations <p> <li> <li> <p> Internal collaboration around decisionmaking for on and offchain votes <p> <li> <li> <p> Ensure Gauntlet maintains a 100 voting and participation rate <p> <li> <li> <p> Proactively identify revenue opportunities that identify with Gauntlets product suite <p> <li> <li> <p> Actively seek increased and net new delegation <p> <li> <li> <p> Maintain active reporting on decidedupon metrics for internal tracking <p> <li> <li> <p> Work crossfunctionally as needed with Data Science Product and Engineering <p> <li> <li> <p> Maintain a pulse and viewpoint on emerging trends in DeFi and adjacent industries <p> <li> <ul> <p> <p> <p> <strong> Qualifications <strong> <p> <ul> <li> <p> Demonstrated DeFi native governanceDAO experience <p> <li> <li> <p> Deep understanding of the DeFi landscape and emerging trends <p> <li> <li> <p> Comfortable working crossfunctionally with Product Engineering Data Science and Finance teams to ensure successful outcomes <p> <li> <li> <p> Excellent verbal and written communication skills <p> <li> <li> <p> Exceptional attention to detail and ability to prioritize <p> <li> <li> <p> Ability to operate autonomously and across multiple time zones <p> <li> <li> <p> You have an analytical background <p> <li> <ul> <p> <p> <p> <strong> Bonus Points <strong> <p> <ul> <li> <p> You have a cryptonative network <p> <li> <li> <p> Youve served as a delegate in a large DAO participated in a blockchain club or professional delegate <p> <li> <li> <p> Youve served as a governance lead for your organization in a bluechip protocol <p> <li> <li> <p> Youve held positions on grants councils or similar <p> <li> <li> <p> You have a technical or mathematical background and are able to disseminate technical topics to nontechnical audiences <p> <li> <ul> <p> <p> <p> <strong> Benefits and Perks <strong> <p> <ul> <li> <p> Remote first work from anywhere in the US amp CAN <p> <li> <li> <p> Regular inperson company retreats and crosscountry office visit perk <p> <li> <li> <p> 100 paid medical dental and vision premiums for employees <p> <li> <li> <p> Laptop monitor keyboard and mouse setup provided <p> <li> <li> <p> $1000 WFH stipend <p> <li> <li> <p> Monthly reimbursement for home internet phone and cellular data <p> <li> <li> <p> Unlimited vacation <p> <li> <li> <p> 100 paid parental leave of 12 weeks <p> <li> <li> <p> Fertility benefits <p> <li> <li> <p> Opportunity for incentive compensation <p> <li> <ul> <p> <p> <p> <p> <p> <strong> Please note at this time our hiring is reserved for potential employees who are able to work within the contiguous United States and Canada Should you need alternative accommodations please note that in your application <strong> <p> <p> <p> <p> <em> The national pay range for this role is $120000 base plus additional On Target Earnings potential by level and equity in the company Our salary ranges are based on paying competitively for a company of our size and industry and are one part of many compensation benefits and other reward opportunities we provide Individual pay rate decisions are based on a number of factors including qualifications for the role experience level skill set and balancing internal equity relative to peers at the company <em> <p> <p> <p> <p> LIRemote <p><p>
Customer Success Manager - Strategic Accounts
Company: Seamless.AI
Location: USA
Posted Apr 30, 2024
The job posting is for a Customer Success Manager position at Seamless AI, a company recognized for its innovative B2B search engine. The role involves managing strategic accounts, driving growth, and ensuring customer satisfaction. Key responsibilities include engaging with customers, leading renewals, developing expansion strategies, and maintaining accurate records. The ideal candidate should have a Bachelor's degree, 5+ years of experience in sales or customer success, excellent communication skills, and the ability to learn new technologies quickly.
Procurement Engineer (Electrical Commodity)
Company: Qcells
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> Hanwha Q CELLS USA Corp HQC US develops invests and delivers solar photovoltaic PV and battery energy storage systems BESS projects through Engineering Procurement Construction EPC services in North America <p> <p> <p> <p> The company brings a decade of global leadership in solar PV to deliver utilityscale power generation plants customized for local and regional energy markets HQC US offers the full spectrum of PV solutions from the core technology of cells and modules to largescale project development and investment With proven capabilities across the solar and battery storage value chain HQC US minimizes uncertainty and risk and helps customers achieve a higher return on their investment in renewable energy <p> <p> <p> <p> <strong> SUMMARY <strong> <p> <p> The Procurement Engineer will serve as the lead technical representative for the Procurement organization for their assigned commodities They will be responsible for performing the purchase process for major equipment transformers inverters BESS electrical BOS etc from RFP to purchase ordercontract execution in conjunction with other members of the team Additional responsibilities will include identifying and assessing new vendors and emerging technologies maintaining a database of current suppliers supporting the prequalification process and monitoring supplier performance Works closely with key suppliers that support the overall strategic objectives of the organization and ensure reliable support and supply of materials to projects May be assigned other tasks as needed This position reports to the Procurement Manager or another management personnel that the President of the Company may designate This position is remote eligible with required travel to Qcells HQ in Irvine CA and other locations as needed Working hours are Monday through Friday from 800am to 500pm or 900am to 600pm local time This position is expected to travel up to 15 <p> <p> <em> <em> <p> <p> <p> <p> <p> <p> <strong> ESSENTIAL JOB FUNCTION amp RESPONSIBILITIES <strong> <p> <ul> <li> <p> Regular attendance in accordance with companys attendance policy and supervisory assignment is an essential job duty requirement for this position and <p> <li> <li> <p> Collaborate with internal and external stakeholders to optimize the procurement of materials andor services <p> <li> <li> <p> Manage key procurement processes in alignment with Companies overall strategic goals <p> <li> <li> <p> Explore new technologies lead the evaluation and benchmarking of new products to determine the potential financial and performance value of the products and potential impacts if implemented <p> <li> <li> <p> Act as liaison between Procurement and vendor and internal engineering teams <p> <li> <li> <p> Administers the RFP process including but not limited to the following <p> <li> <li> <p> Prepare RFPs to qualified suppliers including working with other functional groups to gather all required documents and data <p> <li> <li> <p> Determine and maintain bid schedules in accordance with project schedules <p> <li> <li> <p> Coordinate responses to RFIs from bidders <p> <li> <li> <p> Review compare and evaluate supplier proposals with historical and market pricing to determine costcompetitive pricing and identify opportunities for cost savings <p> <li> <li> <p> Support commercial negotiations for Equipment Supply Agreements project specific orders change orders etc with key suppliers in accordance with company policies and guidelines <p> <li> <li> <p> Administer change order process for suppliers and other related contract management processes <p> <li> <li> <p> Ensure prime contract flow downs are incorporated into subcontract documents as needed or applicable to scope of worksupply <p> <li> <li> <p> Monitor supplier compliance to contract terms and project requirements <p> <li> <li> <p> Support Project Management and Operations teams as needed with contract information and input to resolve supplier issues such as underperformance or scope gaps <p> <li> <li> <p> Evaluate vendor performance and develop improvement processes based on lessons learned <p> <li> <li> <p> Evaluate vendor products systems and structure for quality and performance <p> <li> <li> <p> Ensure compliance with industry standards best practices and requirements <p> <li> <li> <p> Support Project Management Team as needed with urgent procurement needs <p> <li> <li> <p> Maintain accurate and complete purchasing records in accordance with record retention procedures <p> <li> <li> <p> Support qualification and onboard new vendors and <p> <li> <li> <p> Perform other duties and special projects as assigned by Management <p> <li> <ul> <p> <p> <p> <strong> REQUIRED QUALIFICATIONS <strong> <p> <ul> <li> <p> Requires BS degree in Electrical Engineering <p> <li> <li> <p> 35 years of prior relevant experience or equivalent combination of education and directly related experience General knowledge of supply chain management and procurement as well as construction principles and processes <p> <li> <li> <p> Minimum 2 years of experience in solar andor construction field project at the project size of over $30M in procurement of equipmentmaterial or subcontracting <p> <li> <li> <p> Experience in Solar or Renewable Energy <p> <li> <li> <p> Knowledge of major electrical equipment used in the construction of renewable energy facilities inverters transformers etc <p> <li> <li> <p> Knowledge of and ability to read and interpret drawings and specifications <p> <li> <li> <p> Knowledge of negotiated bids lump sum and DesignBuild processes preferred <p> <li> <li> <p> Working knowledge of PVSyst AutoCAD Microsoft 365 suite Bluebeam etc <p> <li> <li> <p> Strong math and analytical skills <p> <li> <li> <p> Knowledge of contract management <p> <li> <li> <p> Ability to work autonomously in a fast pace professional team environment with minimal supervision <p> <li> <li> <p> Ability to prioritize tasks appropriately and in support of project schedules and other deadlines <p> <li> <li> <p> Excellent organizational skills and attention to detail <p> <li> <li> <p> Strong verbal and written communication skills <p> <li> <li> <p> Confidence communicator and ability to interact with people at all levels of the organization <p> <li> <li> <p> Experience in conducting supplier reviews and evaluation and maintaining good business relationships <p> <li> <li> <p> Strong understanding of construction management software systems Procore preferred <p> <li> <li> <p> SAP Experience preferred <p> <li> <ul> <p> <p> <p> <p> <p> The abovelisted salary range is required by the California Pay Transparency Act and may differ depending on the location of those candidates hired nationwide The salary range shared in the job description is for the listed position and only pertains to the candidate if they work in Irvine CA Actual compensation is influenced by a wide array of factors including but not limited to internal pay equity skill set education licenses and certifications geographic location essential job duties and requirements and the necessary experience relative to the jobs minimum qualifications An additional discretionary bonus structure or incentives may be offered as part of the overall compensation package in addition to the full range of medical dental andor other benefits dependent on the level and position offered <p> <p> <p> <p> <strong> PHYSICAL DEMANDS <strong> <p> <p> <strong> <strong> <p> <p> Stationary Position frequently remains stationary up to 90 of the time and sitting up to 8 hours in a day <p> <p> MoveTraverse infrequently bend stand stoop andor walk <p> <p> Carry Weight infrequently carry weight andor lift objects light to heavy weighing up to 10 pounds <p> <p> Hearing and Speech frequently communicates with the ability to hear and talk on a regular basis with employees coworkers and all personnel matters must be able to exchange accurate information in these situations <p> <p> Sight frequent use of sight to detect images on computer office documents and office objects near and far <p> <p> Climb occasionally ascendsdescends on stairway to get to office upper and lower floors <p> <p> Travel review above travel requirement for this position <p> <p> <p> <p> <strong> WORK ENVIRONMENT <strong> <p> <p> <strong> <strong> <p> <p> Regular professional office business setting <p> <p> Noise level ranges from low to moderate if in office setting <p> <p> Noise level ranges from moderate to high if on construction worksite <p> <p> <p> <p> <em> Hanwha Q Cells is proud to be an atwill Equal Opportunity Employer and prohibits discrimination against race color religion sex sexual orientation gender perception or identity national origin age marital status pregnancy citizenship disability protected veteran status and any other classification protected by applicable federal state or local law This policy applies to all terms and conditions of employment including recruiting hiring placement promotion termination layoff recall transfer leaves of absence compensation and training <em> <p> <p> <em> <em> <p> <p> <em> We are committed to the full inclusion of all qualified individuals As part of this commitment Hanwha Q Cells will provide reasonable accommodations to all qualified individuals with disabilities to participate in the job application or interview process to perform essential job functions andor to receive other benefits and privileges of employment Please contact us to request accommodations at <em> <a class=fontbold underline fontbold underline postingslink href=mailtohrusaqcellscom rel=noopener noreferrer nofollow target=blank> <em> hrusaqcellscom <em> <a> <em> <em> <p> <p> <em> <em> <p> <p> <em> Nothing in this statement shall imply implicitly or explicitly a guarantee of employment outside our atwill employment opportunity <em> <p> <p> <p> <p> You may view your privacy rights by reviewing Qcells <a class=fontbold underline fontbold underline postingslink href=httpshqamericasboxcomsyox07qmkqxc5o1rw77oqb32459v9pn76 rel=noopener noreferrer nofollow target=blank> Privacy Policy here <a> or contacting our <a class=fontbold underline fontbold underline postingslink href=mailtohruseqcellscom rel=noopener noreferrer nofollow target=blank> HR Team <a> for a copy <p><p>
Senior Software Engineer - AI
Company: Synack
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> At Synack we create technology that unleashes the best cybersecurity talent to secure our digital world <p> <p> We protect leading global organizations by reducing companies security risk and increasing their resistance to cyber attack How do we do this By utilizing the worlds best and most trusted team of ethical hackers who test through our powerful and controlled platform to deliver real security without compromise <p> <p> Backed by toptier venture capital firms including Kleiner Perkins Caufield amp Byers Microsoft and Google Ventures Synacks mission is to leverage global security talent coupled with advanced technology to help enterprises discover security vulnerabilities before they become business problems Discover the possibilities at Synack <p> <p> We are looking for a Senior Software Engineer AI where youll be spearheading the development of cuttingedge AIdriven solutions tailored for the offensive security sector This role demands a handson approach to designing developing and deploying machine learning models that address specific cybersecurity challenges enhancing our product offerings and meeting our customers critical needs Youll lead by example mentoring junior engineers and promoting a culture of technical excellence innovation and continuous improvement <p> <p> Sounds interesting Keep reading <p> <p> <strong> Please note <strong> This is a remote position based in the US We can only hire US citizens for this position due to federal government contract requirements <p> <p> <p> <p> <strong> Heres what youll do <strong> <p> <ul> <li> <p> Design implement and deliver scalable AI and machine learning solutions <p> <li> <li> <p> Develop robust AI models capable of identifying vulnerabilities automating penetration testing processes workflow optimization and enhancing threat intelligence <p> <li> <li> <p> Own and drive the endtoend development of AI product features from ideation to deployment monitoring and model management <p> <li> <li> <p> Actively participate in and contribute to design and implementation of AI solutions promoting best practices during the project lifecycle <p> <li> <li> <p> Lead technical discussions code reviews and design sessions sharing your expertise to uplift the teams capabilities <p> <li> <li> <p> Provide mentorship and support to junior engineers encouraging professional growth and development <p> <li> <li> <p> Collaborate closely with crossfunctional teams to integrate AI capabilities into broader systems and applications <p> <li> <ul> <p> <strong> Heres what youll need <strong> <p> <ul> <li> <p> 10+ years of experience in machine learning engineering with a strong foundation in statistics mathematics or a related field <p> <li> <li> <p> 3+ years of demonstrated experience in designing and implementing machine learning models and data pipelines in production environments <p> <li> <li> <p> Excellent problemsolving skills with the ability to translate complex business requirements into technical solutions <p> <li> <li> <p> Strong communication skills capable of presenting findings and insights to both technical and nontechnical audiences <p> <li> <li> <p> Proficient in Python and strong understanding of AI and machine learning algorithms and frameworks eg Tensorflow PyTorch <p> <li> <li> <p> Strong knowledge of data management systems both SQL eg PostgreSQL and NoSQL egMongoDB <p> <li> <li> <p> Demonstrated ability to work effectively in a teamoriented collaborative environment <p> <li> <ul> <p> <strong> Nice To Have <strong> <p> <ul> <li> <p> Expertise in AI and ML technologies especially Azure AI and Open AI demonstrating the ability to integrate into software solutions <p> <li> <li> <p> Interest or experience in Cyber Security <p> <li> <ul> <p> <strong> Ready to join us <strong> <p> <p> Synack is committed to embracing diversity Our people are our strength Each addition to our team is an opportunity to grow and diversify our ideas experiences and viewpoints We strive to be inclusive of Race Ethnicity Religion Sex LGBTQ+ Veterans Disabilities and Age Synack welcomes you <p> <p> As a candidate Synack cares about your privacy Please view our candidate privacy policy <a class=fontbold underline fontbold underline fontbold underline href=httpswwwsynackcomcandidateprivacynotice rel=noopener noreferrer nofollow target=blank> here <a> <p> <p> <strong> $145000 $235000 py <strong> Salary is determined by a combination of factors including location level relevant experience and skills The range displayed on each job posting reflects the minimum and maximum target for new hire salaries for the position across all US locations The compensation package for this position may also include equity and benefits For more details about our benefits please see <a class=fontbold underline fontbold underline fontbold underline href=httpssynackmybenefitslife rel=noopener noreferrer nofollow target=blank> here <a> Then for the Employer code enter <strong> synack <strong> <p><p>