Full Time Jobs in Milan, Italy

4,060 open positions · Updated daily

Looking for Full Time jobs in Milan, Italy? Browse our curated listings with transparent salary information to find the perfect Full Time position in the Milan, Italy area.

Cook NA-04

Company: Department of the Army

Location: Vicenza, Italy Vicenza, Italy

Posted Mar 06, 2024

This text provides instructions on how to apply for a job position. It outlines two methods of submission: electronically via the USAJobs website using the Vacancy Number 12302069, and manually through instructions in the 'Additional Information' section. The announcement closes at 11:59 PM Eastern Time on the specified closing date. Contact information for the Vicenza NAF HRO is provided, including a phone number, email, and address. The text concludes by stating that resumes will be reviewed to verify qualifications.

Recreation Assistant (Physical Fitness) NF-02

Company: Department of the Army

Location: Vicenza, Italy Vicenza, Italy

Posted Mar 06, 2024

This text provides instructions on how to apply for a job position. It outlines two methods of submission: electronically through the USAJobs website using the Vacancy Number 12296139, and manually by following instructions in the 'Additional Information' section. The announcement closes at 11:59 PM Eastern Time on the specified closing date. Contact information for the Vicenza NAF HRO is provided, including a phone number, email, and address. The text concludes by stating that resumes will be reviewed to verify qualifications.

Customer Care Specialist

Company: Unger Academy

Location: Italy

Posted Dec 28, 2023

Unger Academy, an Italian multinational company founded by a 4-time World Trading Champion, is seeking an experienced Customer Care Specialist. The role involves sales support, follow-ups with prospects, post-sales support, resolving customer care requests, monitoring NPS responses, and strategizing for service excellence. The ideal candidate should be a self-starter, have excellent people skills, a passion for continuous learning, and previous customer care experience. The company offers remote work with flexible hours.

Software Developer

Company: Hashlist

Location: France, Brazil, Poland, Italy, India

Posted May 24, 2023

Stellantis, the world's third-largest automobile company, is seeking a Software Developer to join its engineering team. The role involves creating and integrating key components in the end-to-end experience pipeline, focusing on cockpit interfaces for multimodal UX. The ideal candidate should have a degree in Computer Science, experience in C++/Python and Linux, and familiarity with Distributed Service Architecture. Stellantis offers a competitive salary, professional growth opportunities, and the chance to work on sustainable projects.

Recreation Aid NF-01

Company: Department of the Army

Location: Vicenza, Italy Vicenza, Italy

Posted Mar 06, 2024

Help Help How to Apply You may submit your application package using one of the two methods identified below Electronically preferred at httpswwwusajobsgov and search for Vacancy Number VIN 12300104 Announcement closes at 1159 PM Eastern Time on the closing date listed on this announcement Manually Please refer to the Additional Information section of this announcement for instructions Agency contact information Vicenza NAF HRO Vicenza NAF HRO Phone 00390509658166 Email usarmyusagitalyhqdacpaclistnafarmymil Address JNNAFW6E7AA USAG VICENZA DO NOT MAIL APO AE 09630 US Learn more about this agency Next steps Your resume will be reviewed to verify that qualification requirements have been met We appreciate your interest in this position

Bowling Equipment Worker NA-05

Company: Department of the Army

Location: Vicenza, Italy Vicenza, Italy

Posted Mar 06, 2024

Help Help How to Apply You may submit your application package using one of the two methods identified below Electronically preferred at httpswwwusajobsgov and search for Vacancy Number VIN 12294462 Announcement closes at 1159 PM Eastern Time on the closing date listed on this announcement Manually Please refer to the Additional Information section of this announcement for instructions Agency contact information Vicenza NAF HRO Vicenza NAF HRO Phone 00390509658166 Email usarmyusagitalyhqdacpaclistnafarmymil Address JNNAFW6E7AA USAG VICENZA DO NOT MAIL APO AE 09630 US Learn more about this agency Next steps Your resume will be reviewed to verify that qualification requirements have been met We appreciate your interest in this position

Senior People Business Partner

Company: Musixmatch

Location: Italy

Posted Jun 23, 2023

None Found

iOS Engineer

Company: Qonto

Location: Milan

Posted Jan 24, 2023

None Found

Laravel Developer

Company: Plentific

Location: UK, Germany, Portugal, Poland, Italy, Turkey, Spain

Posted Nov 06, 2023

Plentific, a global real-time property solutions company, is seeking top talent for a fully remote position based in the UK, Germany, Turkey, Poland, Italy, Spain, or Portugal. The role involves developing and maintaining Laravel based projects. Requirements include at least 2 years of experience in modern PHP frameworks, good knowledge of frontend frameworks, HTML, JavaScript, CSS, and Git. The company offers a competitive compensation package, flexible working environment, private health care, enhanced parental leave, life insurance, employee assistance program, company volunteering day, charity salary sacrifice scheme, learning management system, learning and development fund, referral bonus, season ticket loan, cycle to work, electric vehicle and Techscheme programs, pension, weekly lunch, and regular social gatherings.

Expansion Manager Italy (m/f/d) - B2B and SaaS

Company: Fiskaly

Location: Italy

Posted Feb 12, 2024

The job posting describes a remote role for a go-to-market strategy planner and executor for Italy. The successful candidate will be the figurehead for the company's expansion into Italy, with the potential to become country manager. Responsibilities include reaching out to businesses, attending industry events, promoting a solutions-based sales approach, and participating in sales and marketing activities. The ideal candidate should have at least 3 years of sales/business development experience, preferably in SaaS, retail, PoS, fintech, payment, or hospitality industries. Fluency in Italian and English is required. The company offers a gross salary between EUR 50k - 60k/year, flexible working hours, domain knowledge trainings, and autonomy. The company values diversity and encourages applications from all backgrounds.

CYP Leader

Company: Department of the Navy

Location: Naples, Italy Naples, Italy

Posted Mar 06, 2024

Help Help How to Apply To be considered for this vacancy you must apply and complete the online questionnaire and submit the documentation specified in the Required Documents section above The complete application package must be submitted by 1159 PM EST on 09302024 to receive consideration To begin click Apply to access the online application You will need to be logged into your USAJOBS account to apply If you do not have a USAJOBS account you will need to create one before beginning the application To preview the Application Questionnaire please click the following link httpsapplyusastaffinggovViewQuestionnaire12268643 Additional information on how to complete the online application process and submit your online application may be found on the httpshelpusastaffinggovApplyindexphptitle=Applicant To verify or check the status of your application log into your USAJobs account Once logged in the Welcome screen lists your applications your application status and the date it was last updated For information on what each Application Status means visit httpswwwusajobsgovHelphowtoapplicationstatus DON is an Equal Employment Opportunity Employer All qualified candidates will receive consideration without regard to race color national origin religion sex age mental or physical disability genetic information reprisal marital status political affiliation sexual orientation or any other nonmerit factor The DON provides reasonable accommodations to applicants with disabilities Applicants with disabilities who believe they may require reasonable accommodations should email their request to MILLHQNAFHRFCTnavymil to ensure proper consideration is given Agency contact information CNRE NAF HRO CNRE NAF HRO Phone 0815682838 Email NAFPersonneleunavymil Address Region NAF HRO NSA Naples PSC 817 Box 108 FPO AE 096220108 US Learn more about this agency Next steps Using the required qualifications of the position a standardized rating and ranking criteria of knowledge skills and abilities will be used to screen and assess each application If you provided an email address you will receive an email message acknowledging receipt of your application Times may vary during the hiring process as your application status updateschanges you will be notified with a notification letter via email Please notify us if your contact information changes after the closing date of the announcement Also note that if you provide an email address that is inaccurate or if your mailbox is full or blocked eg Spam Blocker etc you may not receive important communication that could affect your consideration for this position

Hotel Customer Service Agent NF-02

Company: Department of the Army

Location: Vicenza, Italy Vicenza, Italy

Posted Mar 06, 2024

Help Help How to Apply You may submit your application package using one of the two methods identified below Electronically preferred at httpswwwusajobsgov and search for Vacancy Number VIN 12300090 Announcement closes at 1159 PM Eastern Time on the closing date listed on this announcement Manually Please refer to the Additional Information section of this announcement for instructions Agency contact information Vicenza NAF HRO Vicenza NAF HRO Phone 00390509658166 Email usarmyusagitalyhqdacpaclistnafarmymil Address JNNAFW6E7AA USAG VICENZA DO NOT MAIL APO AE 09630 US Learn more about this agency Next steps Your resume will be reviewed to verify that qualification requirements have been met We appreciate your interest in this position

Frequently Asked Questions

What are typical salary ranges for Full Time tech roles by seniority?
Junior software engineer: $70k–$90k. Mid‑level: $90k–$120k. Senior: $120k–$160k. Lead/Staff: $160k–$200k. Principal/Director: $200k–$260k. These ranges reflect U.S. averages and vary by city (e.g., San Francisco vs. Austin).
What skills and certifications are most valuable for Full Time positions?
Core tech stacks (Java, Python, Go) plus cloud expertise (AWS Certified Solutions Architect, Azure Fundamentals, GCP Professional Data Engineer) and container orchestration (Certified Kubernetes Administrator) drive hiring. Security credentials like CISSP or CompTIA Security+ are mandatory for security‑centric roles. Mastery of CI/CD tooling (GitHub Actions, CircleCI) and data tools (Snowflake, BigQuery) also boost competitiveness.
Is remote work available for Full Time tech roles?
Yes—over 70% of full‑time listings offer remote or hybrid options. Companies typically require a home office with a dedicated desk, dual‑monitor setup, and a 44‑hour workweek split between on‑site meetings and remote coding sessions. Remote roles often include a stipend for internet and electricity, and some firms provide a quarterly stipend for home‑office upgrades.
What career progression paths exist for Full Time tech employees?
Typical paths: Engineer I → Engineer II → Senior Engineer → Staff Engineer → Principal Engineer → Director. For product: Associate PM → PM → Senior PM → Product Lead → VP Product. Advancement hinges on measurable impact (e.g., feature launch velocity, code quality improvements) and leadership of cross‑functional initiatives.
What industry trends affect Full Time tech employment?
Artificial intelligence, cloud‑native architecture, edge computing, and cybersecurity are reshaping the full‑time landscape. Companies prioritize talent that can develop AI models, orchestrate microservices with Kubernetes, and harden systems against zero‑trust attacks. Those who stay current with emerging tools and frameworks—such as TensorFlow, Pulumi, and Chaos Engineering practices—see higher demand and better compensation.

Related Pages