Loan Repayment Program Jobs in USA
353,889 open positions · Updated daily
Looking for Loan Repayment Program jobs in USA? Browse our curated listings with transparent salary information to find the perfect Loan Repayment Program position in the USA area.
Client Development Director - Channel Partnerships
Company: StackAdapt
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> StackAdapt is a selfserve advertising platform that specializes in multichannel solutions including native display video connected TV audio ingame and digital outofhome ads We empower hundreds of digitallyfocused companies to deliver outcomes and exceptional campaign performance everyday StackAdapt was founded with a vision to be more than an advertising platform its a hub of innovation imagination and creativity <p> <p> <p> <p> Are you a proactive problem solver with a passion for programmatic advertising Are you a relationship builder with strong interpersonal communication skills If so then we want to hear from you Were looking for a Client Development Manager to join our expanding Channel Partnerships team in a specialist capacity <p> <p> <p> <p> You will become a foremost expert on the StackAdapt platform while owning the growth and success of enterprise level channel partners post sale The ideal candidate will manage a group of accounts with the goal of exceeding StackAdapts customer success standards building valuable relationships across executive and operator levels and driving new business using a consultative partner based sales approach <p> <p> <p> <p> Successful candidates will be self motivated with a strong track record of quickly understanding client technical needs and business objectives to recommend the right solutions to achieve goals <p> <p> <p> <p> StackAdapt is a Remote First company we are open to candidates located anywhere in the US for this position <p> <p> <p> <p> <p> <p> <strong> What youll be doing <strong> <p> <ul> <li> <p> Act as StackAdapts principle evangelist media thought leader problem solver and point of contact across your account portfolio <p> <li> <li> <p> Accurately forecast business needs and account growth while maintaining a clean pipeline of incremental opportunities <p> <li> <li> <p> Own build and run the rhythm of business across your portfolio through the use of status calls strategy calls office hours QBRs and more <p> <li> <li> <p> Identify and pitch key incremental sales opportunities develop client enablement plans and work cross functionally within StackAdapt to solve client needs and develop new opportunities <p> <li> <ul> <p> <p> <p> <strong> What youll bring to the table <strong> <p> <ul> <li> <p> High level of experience managing enterprise clients within the programmatic advertising space preferably at a Demand Side Platform Trading Desk or Media Agency <p> <li> <li> <p> Comfortable working within a quota based environment with a track record of exceeding targets and successfully growing account portfolios <p> <li> <li> <p> Positive energy proactive mentality highly organized with a growth mindset <p> <li> <li> <p> Bonus if you have worked with API based media clients at a Demand Side Platform <p> <li> <ul> <p> <p> <p> <strong> StackAdapters Enjoy <strong> <p> <ul> <li> <p> Competitive salary + commissions <p> <li> <li> <p> 401K matching <p> <li> <li> <p> 3 weeks vacation + 3 personal care days + 1 Culture amp Belief day + birthdays off <p> <li> <li> <p> Access to a comprehensive mental health care platform <p> <li> <li> <p> Health benefits from day one of employment <p> <li> <li> <p> Work from home reimbursements <p> <li> <li> <p> Optional global WeWork membership for those who want a change from their home office <p> <li> <li> <p> Robust training and onboarding program <p> <li> <li> <p> Coverage and support of personal development initiatives conferences courses etc <p> <li> <li> <p> Access to StackAdapt programmatic courses and certifications to support continuous learning <p> <li> <li> <p> Mentorship opportunities with industry leaders <p> <li> <li> <p> An awesome parental leave policy <p> <li> <li> <p> A friendly welcoming and supportive culture <p> <li> <li> <p> Our social and team events <p> <li> <ul> <p> <p> <p> <p> <p> <p> <p> <p> <p> <em> StackAdapt is a diverse and inclusive team of collaborative hardworking individuals trying to make a dent in the universe No matter who you are where you are from who you love follow in faith disability or superpower status ethnicity or the gender you identify with if youre comfortable let us know your pronouns you are welcome at StackAdapt If you have any requests or requirements to support you throughout any part of the interview process please let our Talent team know <em> <p> <p> <p> <p> <strong> About StackAdapt <strong> <p> <p> <p> <p> Weve been recognized for our diverse and supportive workplace high performing campaigns awardwinning customer service and innovation Weve been awarded <p> <p> <p> <p> <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpsblogstackadaptcomstackadaptnamedadagesbestplacetowork2024utmsource=linkedinamputmmedium=organicsocialamputmcampaign=adagesbestplacetowork2024amputmcontent=blog rel=noopener noreferrer nofollow target=blank> Ad Age Best Places to Work 2024 <a> <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpsblogstackadaptcomg22024bestsoftwareawards rel=noopener noreferrer nofollow target=blank> G2 Top Software and Top Marketing and Advertising Product for 2024 <a> <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpsblogstackadaptcom2023bestplacestoworkuk rel=noopener noreferrer nofollow target=blank> Campaigns Best Places to Work 2023 for the UK <a> <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpsblogstackadaptcombestworkplacesforwomenlist rel=noopener noreferrer nofollow target=blank> 2024 Best Workplaces for Women <a> and <a class=fontbold underline fontbold underline postingslink href=httpsblogstackadaptcom2023bestworkplacesincanadalist rel=noopener noreferrer nofollow target=blank> in Canada <a> by Great Place to Work® <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpswwwg2comproductsstackadaptreviews rel=noopener noreferrer nofollow target=blank> 1 DSP on G2 and leader in a number of categories including CrossChannel Advertising <a> <p> <p> <p> <p> LIRemote <p><p>
Senior Backend Engineer - Shared Services
Company: Webflow
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> At Webflow our mission is to bring development superpowers to everyone Webflow is the leading visual development platform for building powerful websites without writing code By combining modern web development technologies into one platform Webflow enables people to build websites visually saving engineering time while clean code seamlessly generates in the background From independent designers and creative agencies to Fortune 500 companies millions worldwide use Webflow to be more nimble creative and collaborative Its the web made better <p> <p> We are looking for a Senior Backend Engineer to join the Shared Services team to enable our engineering team to build more efficiently so we can further our mission of bringing visual development superpowers to everyone If youre passionate about engineering excellence and driving operational efficiency wed love to hear from you <p> <h2> <strong> About the role <strong> <h2> <ul> <li> <p> Location Remotefirst United States BC amp ON Canada <p> <li> <li> <p> Fulltime <p> <li> <li> <p> Permanent <p> <li> <li> <p> Exempt <p> <li> <li> <p> The cash compensation for this role is tailored to align with the cost of labor in different geographic markets Weve structured the base pay ranges for this role into zones for our geographic markets and the specific base pay within the range will be determined by the candidates geographic location jobrelated experience knowledge qualifications and skills <p> <ul> <li> <p> United States all figures cited below in USD and pertain to workers in the United States <p> <ul> <li> <p> Zone A $162500 $216050 <p> <li> <li> <p> Zone B $152700 $203100 <p> <li> <li> <p> Zone C $14300 $190150 <p> <li> <ul> <li> <li> <p> Canada All figures cited below in CAD and pertain to workers in ON amp BC Canada <p> <ul> <li> <p> CAD 184600 CAD 245500 <p> <li> <ul> <li> <ul> <li> <li> <p> Please visit our <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowaboutwebflowiocareers rel=noopener noreferrer nofollow target=blank> Careers page <a> for more information on which locations are included in each of our geographic pay zones However please confirm the zone for your specific location with your recruiter <p> <li> <li> <p> Reporting to the engineering manager <p> <li> <ul> <p> As Senior Backend Engineer youll <p> <ul> <li> <p> Develop a comprehensive knowledge of how areas of business such as architecture and infrastructure integrate to improve developer productivity and accomplish our business goals <p> <li> <li> <p> Collaborate with software engineers product managers designers and QA analysts in an autonomous supportive team environment <p> <li> <li> <p> Build and maintain shared services including but not limited to Inapp Email Notification platform and Feature Flag framework <p> <li> <li> <p> Identify develop and document APIs for Webflows service catalog as well as provide quick start guides for developer best practices <p> <li> <li> <p> Solve problems in a highly technical platform that empowers hundreds of engineers <p> <li> <li> <p> Improve our planning development and deployment processes to help you and your fellow team members <p> <li> <li> <p> Mentor coach and inspire a team of engineers of various levels <p> <li> <ul> <p> In addition to the responsibilities outlined above at Webflow we will support you in identifying where your interests and development opportunities lie and well help you incorporate them into your role <p> <h2> <strong> About you <strong> <h2> <p> Youll thrive in this role if you <p> <ul> <li> <p> Have 5+ years developing and deploying web applications with a proven track record of shipping to market <p> <li> <li> <p> Excellent organization and communication skills both verbal and written <p> <li> <li> <p> Have worked on complex issues where the analysis requires an indepth knowledge of the company and existing architecture <p> <li> <li> <p> Can debug production issues across services and multiple levels of the stack <p> <li> <li> <p> Take pride in taking ownership and driving projects to business impact <p> <li> <li> <p> Proven experience building complex web systems <p> <li> <li> <p> Are familiar with one or more Javascript type systems we use TypeScript here <p> <li> <li> <p> Are comfortable working in an agile safetofail environment <p> <li> <ul> <p> <strong> Our Core Behaviors <strong> <p> <ul> <li> <p> <strong> Obsess over customer experience <strong> We deeply understand <em> what <em> were building and <em> who <em> were building for and serving We define the leading edge of whats possible in our industry and deliver the future for our customers <p> <li> <li> <p> <strong> Move with heartfelt urgency <strong> We have a healthy relationship with impatience channeling it thoughtfully to show up better and faster for our customers and for each other Time is the most limited thing we have and we make the most of every moment <p> <li> <li> <p> <strong> Say the hard thing with care <strong> Our best work often comes from intelligent debate critique and even difficult conversations We speak our minds and dont sugarcoat things and we do so with respect maturity and care <p> <li> <li> <p> <strong> Make your mark <strong> We seek out new and unique ways to create meaningful impact and we champion the same from our colleagues We work as a <em> team <em> to get the job done and we go out of our way to celebrate and reward those going above and beyond for our customers and our teammates <p> <li> <ul> <h3> <strong> Benefits amp wellness <strong> <h3> <ul> <li> <p> Equity ownership RSUs in a growing privatelyowned company <p> <li> <li> <p> 100 employerpaid healthcare vision and dental insurance coverage for employees and dependents fulltime employees working 30+ hours per week as well as Health Savings AccountHealth Reimbursement Account dependent care Flexible Spending Account US only dependent on insurance plan selection where applicable in the respective country of employment Employees may also have voluntary insurance options such as life disability hospital protection accident and critical illness where applicable in the respective country of employment <p> <li> <li> <p> 12 weeks of paid parental leave for both birthing and nonbirthing caregivers as well as an additional 68 weeks of pregnancy disability for birthing parents to be used before child bonding leave where local requirements are more generous employees receive the greater benefit Employees also have access to family planning care and reimbursement <p> <li> <li> <p> Flexible PTO with a mandatory annual minimum of 10 days paid time off for all locations where local requirements are more generous employees receive the greater benefit and sabbatical program <p> <li> <li> <p> Access to mental wellness and professional coaching therapy and Employee Assistance Program <p> <li> <li> <p> Monthly stipends to support health and wellness smart work and professional growth <p> <li> <li> <p> Professional career coaching internal learning amp development programs <p> <li> <li> <p> 401k plan and pension schemes in countries where statutorily required financial wellness benefits like CPA or financial advisor coverage <p> <li> <li> <p> Discounted Pet Insurance offering US only <p> <li> <li> <p> Commuter benefits for inoffice employees <p> <li> <ul> <h3> <strong> Be you with us <strong> <h3> <p> At Webflow equality is a core tenet of our culture We are an Equal Opportunity EEOVeteransDisabled Employer and are <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomdiversityequityinclusion rel=noopener noreferrer nofollow target=blank> committed <a> to building an inclusive global team that represents a variety of backgrounds perspectives beliefs and experiences Employment decisions are made on the basis of jobrelated criteria without regard to race color religion sex sexual orientation gender identity national origin disability veteran status or any other classification protected by applicable law Pursuant to the San Francisco Fair Chance Ordinance Webflow will consider for employment qualified applicants with arrest and conviction records <p> <h3> <strong> Stay connected <strong> <h3> <p> Not ready to apply but want to be part of the Webflow community Consider following our story on our <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomblog rel=noopener noreferrer nofollow target=blank> Webflow Blog <a> <a class=fontbold underline fontbold underline fontbold underline href=httpswwwlinkedincomcompanywebflowinc rel=noopener noreferrer nofollow target=blank> LinkedIn <a> <a class=fontbold underline fontbold underline fontbold underline href=httpstwittercomwebflow rel=noopener noreferrer nofollow target=blank> X Twitter <a> andor <a class=fontbold underline fontbold underline fontbold underline href=httpswwwglassdoorcomReviewsWebflowReviewsE890506htm rel=noopener noreferrer nofollow target=blank> Glassdoor <a> <p> <h3> <strong> Please note <strong> <h3> <p> <em> To join Webflow youll need valid US or Canadian work authorization depending on the country of employment <em> <p> <p> <em> If you are extended an offer that offer may be contingent upon your successful completion of a background check which will be conducted in accordance with applicable laws We may obtain one or more background screening reports about you solely for employment purposes <em> <p> <p> <em> For information about how Webflow processes your personal information please review <em> <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomlegalapplicantprivacynotice rel=noopener noreferrer nofollow target=blank> <em> Webflows Applicant Privacy Notice <em> <a> <em> <em> <p> <p> <p><p>
Senior Software Engineer - Cosmos Platform
Company: Bishop Fox
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> Bishop Fox is the leading authority in offensive security providing solutions ranging from continuous penetration testing red teaming and attack surface management to product cloud and application security assessments Weve worked with more than a quarter of the Fortune 100 half of the Fortune 10 eight of the top 10 global technology companies and all of the top global media companies Our Cosmos platform service innovation and culture of excellence continue to gather accolades from industry award programs including Fast Company Inc SC Media and others For more than 16 years weve been contributing and giving back to the security community Weve published more than 16 open source tools and 50 security advisories in the last five years alone Learn more at bishopfoxcom or follow us on social media <p> <p> Given our exceptional growth we are expanding and hiring a Software Engineer to join us on this exciting journey At Bishop Fox you will join a company of brilliant technologists to help build THE platform for offensive security Cosmos Working on Cosmos you will have the opportunity to build eventdriven domainoriented services across a wide spectrum of offensive security capabilities Each day will bring new challenges and problems to solve If you have strong experience with modern architecture cloud and languages such as Golang and Python are selfmotivated and enjoy solving problems at scale then the Cosmos Platform Engineering team is for you Bring your experience curiosity and will to deliver great technology and join our Cosmos Platform team <p> <h3> Responsibilities <h3> <p> As a member of the Cosmos Platform Engineering team you will design solutions write code and usher software into production You will build services that industrialize the automation of offensive security processes and provide security information to our customers in a scalable secure reliable cloud platform <p> <p> As a Senior Engineer you will take the lead on design solutions drive quality standards and provide technical leadership to the team and broader engineering organization <p> <h3> Requirements <h3> <ul> <li> <p> 5+ years of software development experience <p> <li> <li> <p> Professional experience with Golang or Python required <p> <li> <li> <p> Mastery in the foundations of Golang or Python and strong experience in building microservices in the specified language <p> <li> <li> <p> Experience in a professional software organization using an SDLC <p> <li> <li> <p> Understanding of coding best practices structure patterns unit tests secure coding etc <p> <li> <li> <p> Ability to work independently and also work together with the team to solve complex technical problems <p> <li> <ul> <h3> Preferred Skills and Experience <h3> <ul> <li> <p> Experience with Amazon Web Services AWS <p> <li> <li> <p> Eventdriven and asynchronous systems Rabbit SQS SNS Kafka Kinesis etc <p> <li> <li> <p> Experience using datastores SQL or NoSQL <p> <li> <li> <p> An interest in cybersecurity <p> <li> <ul> <p> Bishop Fox has always allowed its employees to work remotely and this role could work anywhere in the United States Our comprehensive benefits program is tailored to meet your needs at an affordable price We embrace diversity and an inclusive culture We value our employees and who they are which fosters a powerful and collective talent base to successfully serve our clients and the security community with unparalleled expertise <p> <p> <em> Bishop Fox is an Equal Opportunity employer All qualified applicants will receive consideration for employment without regard to race color religion sex including sexual orientation and gender identity national origin disability protected veteran status or any other characteristic protected by applicable federal state or local law All new hires must pass a background check as a condition of employment <em> <p> <p> Interested Apply today <p><p>
Research Associate - siRNA/Peptides + Antibody
Company: Vial
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> <strong> Who We Are <strong> <p> <p> <p> <p> Vial is a global techdriven CRO providing nextgeneration clinical trial management services The Vial CRO powers its drug discovery arm Battery Bio an AIpowered hyper scalable biotech Battery Bio harnesses Vials unique 90 lower cost structure to produce more affordable drug development with efficient streamlined clinical trials <p> <p> <p> <p> Our mission is to reimagine the drug discovery process to empower scientists to cure all human disease We have assembled a talented team of clinical operators chemists and innovative thinkers to achieve this vision <p> <p> <p> <p> Vial is a San Francisco Californiabased company founded by Simon Burns in October 2020 Since our founding we have become a fastgrowing company of 100+ employees with over $100 million in funding from esteemed investors including General Catalyst Box Group and Byers Capital <p> <p> <p> <p> Vial is rebuilding the infrastructure to advance research By deploying technology at every step we are creating a more efficient future for drug discovery <p> <p> <p> <p> <strong> What Youll Do <strong> <p> <p> Work in a structurebased computationally driven drug discovery paradigm <p> <p> Iteratively scale rethink and collaborate on a drug discovery engine that will scale to hundreds of programs <p> <p> Work on assay development and process development for Vials in house discovery efforts <p> <p> Research new modalities + new approaches and serve as a thought partner to the team <p> <p> Work with other scientists clinicians computational biologists project managers and external partners to accomplish our mission of curing diseases <p> <p> <p> <p> <strong> What Youll Bring <strong> <p> <p> 35 years of experience in Antibody discoveryprogram development or roles directly related to the Research amp Development of antibody programs <p> <p> Entrepreneurial mindset experience in startup environment preferred a plus <p> <p> Deeply analytical systems thinker focused on finding scalable solutions <p> <p> <p> <p> <p> <p> <p> <p> $90000 $110000 a year <p> <p> <strong> Why Youll Love Working At Vial <strong> <p> <p> <p> <p> <strong> We are innately curiosity <strong> We found our calling in clinical trials after learning the pain points directly It is our curiosity that propels us to keep building finding new challenges and fulfilling our vision of reimagining clinical trials <p> <p> <strong> We believe in autonomy <strong> Team members do their best work when given autonomy In order to make an impact on the scale of the Vial vision we built our culture to enable each Vial team member to feel ownership of their domain <p> <p> <strong> We take pride in building mastery <strong> We believe in building master in a craft Craftsmanship a pride in ones craft is key to prolonged engagement on a difficult challenge Vials culture is one of highly autonomous deeply focused experts working on an immensely hard problem together <p> <p> <strong> Our strength is moving fast and staying humble <strong> We believe that if we build a team that is intellectually honest that we stay nimble and keep an open mind to all solutions well be adaptive and solve the problems that face us at every turn <p> <p> <p> <p> <strong> Benefits <strong> <em> Not applicable to Contract or Temp Positions <em> <p> <p> Competitive Equity Compensation <p> <p> Comprehensive benefits package including Medical Dental and Vision insurance <p> <p> 401k or RRSP Plan with Company Matching after first 90 days of employment <p> <p> One time Remote Office Setup Stipend <p> <p> Paid Parental Leave <p> <p> RemoteFirst Flexible Work Schedule <p> <p> Unlimited Vacation <p> <p> <p><p>
Director - Corporate FP&A
Company: Icertis
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> With unmatched technology and categorydefining innovation Icertis pushes the boundaries of whats possible with contract lifecycle management CLM The AIpowered analystvalidated Icertis Contract Intelligence ICI platform turns contracts from static documents into strategic advantage by structuring and connecting the critical contract information that defines how an organization runs Today the worlds most iconic brands and disruptive innovators trust Icertis to fully realize the intent of their combined 10 million contracts worth more than $1 trillion in 40+ languages and 93 countries <p> <p> <p> <p> <strong> Who we are <strong> Icertis is the only contract intelligence platform companies trust to keep them out in front now and in the future Our unwavering commitment to contract intelligence is grounded in our FORTE valuesFairness Openness Respect Teamwork and Executionwhich guide all our interactions with employees customers partners and stakeholders Because in our mission to be the contract intelligence platform of the world we believe how we get there is as important as the destination <p> <p> <p> <p> As the Director of FPampA you will play a critical leadership role you will work closely with all of companys functional leaders and bring key market strategic and operational insights that will shape the direction of the company and accelerate its growth You will also play a key role in telling the companys financial story to investors <p> <p> <p> <p> The ideal candidate will have a proven trackrecord of driving business outcomes through keen financial insight and business modeling They will have the ability to create a 360degree financial picture of the business that reflects and influences the companys strategy and be excellent at communicating with senior leaders and executives They will be toolsavvy with experience in creating scalable data and reporting solutions that support a datadriven culture LIRS1 <p> <p> <p> <p> <p> <p> <strong> What you will do <strong> <p> <ul> <li> <p> Formulate a robust 360degree financial picture of the business complete with market insights and operational drivers <p> <li> <li> <p> Develop and maintain the 3year Strategic Planning Model and forecast <p> <li> <li> <p> Deliver Global PampL and cash flow forecasts <p> <li> <li> <p> Drive Annual Planning Process work cross functionally to build and maintain the Annual Financial Plan and Departmental Budgets <p> <li> <li> <p> Build and deliver Business Performance ReportingOperating dashboards <p> <li> <li> <p> Perform strategic business analysis as needed MampA Geo Expansion <p> <li> <li> <p> Prepare financial analyses as needed to help drive improvements in the business Current focus areas include market expansion opportunities competitive benchmarking analyses pricing and strategic financial optimization strategies <p> <li> <li> <p> Partner with Controller to enhance and accelerate the financial reporting process <p> <li> <li> <p> Identifies and implements system and process improvements to increase the efficiency and effectiveness of planning and reporting workflows <p> <li> <li> <p> Prepare communications to Board of Directors <p> <li> <li> <p> Drive investor presentations and supporting analysis <p> <li> <li> <p> Develop a deep understanding of the business metrics with an eye towards understanding the benefits and risks from a financial perspective and helping to manage key business drivers and desired outcomes <p> <li> <li> <p> Play a key role in preparation of critical public financial documents to support the IPO process including working with bankers and supporting the production of investor materials and SEC filings eg S1 <p> <li> <ul> <p> <p> <p> <strong> What you will bring <strong> <p> <ul> <li> <p> 12+ years of experience of working in direct strategic analysis support of all aspects of the business at all areas of the PampL <p> <li> <li> <p> MBACPA or equivalent experience preferred <p> <li> <li> <p> Demonstrated complex modeling experience this is a handson role and managers are expected to directly contribute and lead by example <p> <li> <li> <p> Highly analytical detailoriented with a commitment to creating a highquality product Naturally inquisitive and able to extract information from various sources to identify and understand the underlying issue Not afraid to question results <p> <li> <li> <p> Prior success working in a fastpaced entrepreneurial environment takes initiative and works independently <p> <li> <li> <p> Working knowledge of accounting principles required including revenue recognition amortization and accrual vs cash accounting Must have a general understanding of financial statements <p> <li> <li> <p> Must have exceptional written visual and spoken communication skills <p> <li> <li> <p> Experience in preparing and delivering executive board and investor level communications <p> <li> <li> <p> IPO experience is a plus <p> <li> <li> <p> Must have advanced Excel Netsuite and Powerpoint skills <p> <li> <li> <p> Experience implementing financial analysis and planning tools required <p> <li> <ul> <p> <p> <p> <p> <p> $146000 $219000 a year <p> <p> <em> Pay offered will vary based on jobrelated factors such as location experience training skills and abilities In addition to the base salary and annual bonus target and an equity component is included in the compensation package <em> <p> <p> <strong> What we offer <strong> <p> <p> We are committed to the health and wellbeing of all Icertians their families the communities they live in and our customers This commitment is represented in the Icertis Four Rings of Responsibility Take Care of Self Take Care of Family Take Care of Community and Take Care of Business in that order <p> <p> <p> <p> To support these commitments Icertis offers excellent health and welfare benefits a generous 401k match and a robust paid time off program Here are some of the other reasons <a class=fontbold underline fontbold underline postingslink href=httpswwwicertiscomcompanynewsicertisplacesfirstinwashingtons100bestcompaniestoworkfor rel=noopener noreferrer nofollow target=blank> Icertis Places First in Washingtons 100 Best Companies to Work For | Icertis <a> <p> <p> <p> <p> ● Equity RSUs and shared ownership in the company <p> <p> ● Flexible work environment <p> <p> ● Paid maternity and paternity leave <p> <p> ● 7 Days for Humanity 7 paid volunteer days <p> <p> ● Generous holidays including the 4th of July week off paid <p> <p> ● Free professional and leadership coaching <p> <p> ● Annual personal development allowance <p> <p> <p> <p> Icertis Inc provides Equal Employment Opportunity to all employees and applicants for employment without regard to race color religion gender identity or expression sex sexual orientation national origin age disability genetic information marital status amnesty or status as a covered veteran in accordance with applicable federal state and local laws Icertis Inc complies with applicable state and local laws governing nondiscrimination in employment in every location in which the company has facilities If you are in need of accommodation or special assistance to navigate our website or to complete your application please send an email with your request to <a class=fontbold underline fontbold underline postingslink href=mailtocareersicertiscom rel=noopener noreferrer nofollow target=blank> careersicertiscom <a> or get in touch with your recruiter <p> <p> <p> <p> By submitting your application you acknowledge that you have read Icertiss Privacy Policy <a class=fontbold underline fontbold underline postingslink href=httpswwwicertiscomprivacystatement rel=noopener noreferrer nofollow target=blank> httpswwwicertiscomprivacystatement <a> <p> <p> <p> <p> Icertis is not open to third party solicitation or resumes for our posted FTE positions Resumes received from third party agencies that are unsolicited will be considered complimentary <p><p>
Distributed Systems Engineer, L5 - OC Tools Runtime
Company: Netflix
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> How do you spark joy in hundreds of millions of people It starts with a vision that technology can give voice to stories around the world In delivering those muchloved stories Netflix is responsible for a significant portion of global internet traffic <p> <p> <p> <p> To steward that responsibility we work collaboratively with ISPs to deploy <a class=fontbold underline fontbold underline postingslink href=httpsmedianetflixcomencompanybloghownetflixworkswithispsaroundtheglobetodeliveragreatviewingexperience rel=noopener noreferrer nofollow target=blank> Open Connect <a> Netflixs Content Delivery Network CDN which delivers 100 of Netflixs video traffic Our teams mission is to support that delivery by providing an automation and tooling platform that supports the internal operations and external partnerships needed to provide a fantastic viewing experience for all Netflix members We are looking for a talented software engineer specializing in infrastructure to join us on that mission <p> <p> <p> <p> <strong> The Role <strong> <p> <p> You will be charged with handling impactful availability scalability and usability challenges and must selfdefine optimal ways to configure manage and observe our growing Open Connect platform Our platform is a fundamental building block to our streaming initiatives providing critical solutions for one of the worlds largest CDNs and empowering stakeholders to operate the CDN more efficiently and reliably <p> <p> <p> <p> <p> <p> <p> <p> <strong> In this position you will have the opportunity to work in a wide variety of areas such as <strong> <p> <ul> <li> <p> Implementing microservices to enable analytics insights discovery and visualizations <p> <li> <li> <p> Designing orchestration to manage many thousands of globally distributed appliances and devices <p> <li> <li> <p> Building data models and APIs to help manage and maintain our fleet <p> <li> <li> <p> Understanding the breadth of our multitenant platform creating generalized solutions which can be leveraged across multiple domains including networking video and gaming <p> <li> <ul> <p> <p> <p> <strong> You Are <strong> <p> <ul> <li> <p> Someone who likes to work handson and selfdirect in a fastpaced environment that gives you great freedom and responsibility <p> <li> <li> <p> Able to see beyond immediate specifications can summarize requirements and architect forwardlooking solutions that cross multiple applications <p> <li> <li> <p> Capable of working in a highlycollaborative environment alongside your teammates engineers Partner Engagement Managers project managers and operations teams <p> <li> <li> <p> Articulate in communicating opportunities for continuous improvements to existing systems with a clear understanding of the impact on the business <p> <li> <li> <p> Always striving to develop and deploy in measured increments while taking responsibility for the quality of your work <p> <li> <ul> <p> <p> <p> <strong> Required Skills <strong> <p> <ul> <li> <p> 5+ years of expertise in Java or similar objectoriented language with confidence and experience in debugging and problemsolving skills <p> <li> <li> <p> Deep understanding of cloud architecture and application deployment <p> <li> <li> <p> Ability to build and support highly scalable robust and faulttolerant services <p> <li> <li> <p> Comprehensive knowledge of architecting and maintaining largescale distributed systems while handling high concurrency <p> <li> <li> <p> Experience designing implementing and debugging systems that interact with largesized data sets <p> <li> <li> <p> Excellent verbal and written communication skills <p> <li> <ul> <p> <p> <p> <strong> Bonus Skills <strong> <p> <ul> <li> <p> Knowledge of CDN architectures and networking fundamentals TCPIP BGP DNS <p> <li> <li> <p> Experience with multiple data stores and streaming services such as MySQL Postgres Elasticsearch Cassandra Kafka or Redis <p> <li> <li> <p> Familiarity with GraphQL or related graph modeling and querying concepts <p> <li> <li> <p> Handson Big Data experience using Hive Pig Hadoop or similar <p> <li> <li> <p> Understanding of frontend technologies including HTML CSS JavaScript WebSockets <p> <li> <ul> <p> <p> <p> <p> <p> Does this sound interesting Or does this sound interesting but intimidating Please dont selfselect out lets figure it out together Wed love to talk to you <p> <p> <p> <p> Our culture is unique and we tend to live by our values so its worth learning more about Netflix <a class=fontbold underline fontbold underline postingslink href=httpsjobsnetflixcomculture rel=noopener noreferrer nofollow target=blank> here <a> <p> <p> <p> <p> Our compensation structure consists solely of an annual salary we do not have bonuses You choose each year how much of your compensation you want in salary versus stock options To determine your personal top of market compensation we rely on market indicators and consider your specific job family background skills and experience to determine your compensation in the market range The range for this role is $100000 $720000 <p> <p> <p> <p> Netflix provides comprehensive benefits including Health Plans Mental Health support a 401k Retirement Plan with employer match Stock Option Program Disability Programs Health Savings and Flexible Spending Accounts Familyforming benefits and Life and Serious Injury Benefits We also offer paid leave of absence programs Fulltime hourly employees accrue 35 days annually for paid time off to be used for vacation holidays and sick paid time off Fulltime salaried employees are immediately entitled to flexible time off See more detail about our Benefits <a class=fontbold underline fontbold underline postingslink href=httpsjobsnetflixcomworklifephilosophy rel=noopener noreferrer nofollow target=blank> here <a> <p> <p> <p> <p> Netflix is a unique culture and environment Learn more <a class=fontbold underline fontbold underline postingslink href=httpsjobsnetflixcomculture rel=noopener noreferrer nofollow target=blank> here <a> <p> <p> <p> <p> We are an equalopportunity employer and celebrate diversity recognizing that diversity of thought and background builds stronger teams We approach diversity and inclusion seriously and thoughtfully We do not discriminate on the basis of race religion color ancestry national origin caste sex sexual orientation gender gender identity or expression age disability medical condition pregnancy genetic makeup marital status or military service <p><p>
Machine Learning Engineer (L3)
Company: Twilio
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <h3> <strong> See yourself at Twilio <strong> <h3> <p> Join the team as Twilios next Machine Learning Engineer L3 on the Data Services and Throughput team <p> <h3> <strong> Who we are amp why were hiring <strong> <h3> <p> Twilio powers realtime business communications and data solutions that help <a class=fontbold underline fontbold underline fontbold underline href=httpscustomerstwiliocom rel=noopener noreferrer nofollow target=blank> companies and developers worldwide <a> build better applications and customer experiences <p> <p> Although were headquartered in San Francisco we have presence throughout South America Europe Asia and Australia Were on a journey to becoming a global company that actively opposes racism and all forms of oppression and bias At Twilio we support <a class=fontbold underline fontbold underline fontbold underline href=httpswwwtwiliocomcompanydiversity rel=noopener noreferrer nofollow target=blank> diversity equity amp inclusion <a> wherever we do business <p> <h3> <strong> About the job <strong> <h3> <p> This position is needed to to drive the innovation and creation of cuttingedge products that serve the needs of developers builders and operators You will be a crucial bridge between Product and Design tasked with developing evaluating and maintaining scalable Machine Learning models within lowlatency for realtime applications Your collaboration and expertise will be fundamental in delivering robust solutions that power our users success You will be closely working with a crossfunctional team of engineers architects product UIUX and partners to develop ML and data driven algorithm aspects of customer facing products in Twilio Communication applications <p> <p> Twilio Communications is the leading software for sending messages programmatically The Data Services and Throughput organization builds AIenabled capabilities that separate Twilio from its competitors in messaging capabilities <p> <h3> <strong> Responsibilities <strong> <h3> <p> In this role youll <p> <ul> <li> <p> Build and maintain scalable high quality machine learning solutions in production <p> <li> <li> <p> Design and implement tools and procedures to evaluate performance and accuracy of models and data <p> <li> <li> <p> Work closely with software engineers build tools to enhance productivity and to ship and maintain ML models <p> <li> <li> <p> Demonstrate endtoend understanding of applications and why behind models amp systems and develop high quality MLbased software at scale <p> <li> <li> <p> Truly own the product you work on Be responsible for SLA on call incident resolution customer feedback and participate in blameless postmortems to make our products better <p> <li> <li> <p> Partner with product managers tech leads and stakeholders to analyze business problems clarify requirements and define the scope of the systems and leverage stateoftheart Statistics Machine Learning Deep Learning and Gen AI to address the business problems <p> <li> <li> <p> Drive high engineering standards on the team through code review automated testing and mentoring <p> <li> <li> <p> Collaborate and brainstorm product ideas with product managers designers and engineers <p> <li> <ul> <h3> <strong> Qualifications <strong> <h3> <p> Not all applicants will have skills that match a job description exactly Twilio values diverse experiences in other industries and we encourage everyone who meets the required qualifications to apply While having desired qualifications make for a strong candidate we encourage applicants with alternative experiences to also apply If your career is just starting or hasnt followed a traditional path dont let that stop you from considering Twilio We are always looking for people who will bring something new to the table <p> <p> <strong> Required <strong> <p> <ul> <li> <p> 4+ years of applied ML experience <p> <li> <li> <p> Strong background in the foundations of machine learning and building blocks of modern deep learning <p> <li> <li> <p> Proficiency in Python or Java and familiarity with design patterns <p> <li> <li> <p> Track record of building shipping and maintaining machine learning models in production <p> <li> <li> <p> Extensive experience in technologies such as PyTorch Tensorflow Scikitlearn Spacy NLTK application frameworks eg Flask <p> <li> <li> <p> Deep understanding of ML model implementation cycle eg feature engineering trainingserving AB test model selection etc algorithms eg xgboost time series models deep learning graph neural networks optimization and domains eg forecasting personalization and recommendation system NLP embedding representation <p> <li> <li> <p> Familiarity with MLOps concepts related and maintaining models in production such as testing versioning model registry retraining and monitoring <p> <li> <li> <p> Demonstrated ability to ramp up understand and operate effectively in new application business domains <p> <li> <li> <p> Good written and verbal communication skills You are confident in writing down and presenting your designs and decisions throughout the development lifecycle You are also comfortable providing and receiving feedback in an Agile environment <p> <li> <ul> <p> <strong> Desired <strong> <p> <ul> <li> <p> Experience in recommendation systems forecasting models NLP techniques embedding representation approaches and statistical models <p> <li> <li> <p> Experience with Retrieval Augmented Generation Large Language Models and prompt engineering <p> <li> <li> <p> Knowledge of Java and system design concepts <p> <li> <li> <p> Understanding of Experience with CICD pipelines and automated deployment processes <p> <li> <li> <p> Experience with either AWS Azure or Google Cloud and technologies such as Spark Kafka Kubeflow GPU <p> <li> <ul> <h3> <strong> Location <strong> <h3> <p> This role will be and based in the US but is not eligible to be hired in NY WA CT CA and PA <p> <h3> <strong> Travel <strong> <h3> <p> We prioritize connection and opportunities to build relationships with our customers and each other For this role you may be required to travel occasionally to participate in project or team inperson meetings <p> <h3> <strong> What We Offer <strong> <h3> <p> There are many benefits to working at Twilio including in addition to competitive pay things like generous timeoff ample parental and wellness leave healthcare a retirement savings program and much more Offerings vary by location <p> <h3> <strong> Twilio thinks big Do you <strong> <h3> <p> We like to solve problems take initiative pitch in when needed and are always up for trying new things Thats why we seek out colleagues who embody our values something we call <a class=fontbold underline fontbold underline fontbold underline href=httpswwwtwiliocomcompanyvalues rel=noopener noreferrer nofollow target=blank> Twilio Magic <a> Additionally we empower employees to build <a class=fontbold underline fontbold underline fontbold underline href=httpstwilioorgsupportandresourcesimpactfund rel=noopener noreferrer nofollow target=blank> positive change in their communities <a> by supporting their volunteering and donation efforts <p> <p> So if youre ready to unleash your full potential do your best work and be the best version of yourself apply now <p> <p> If this role isnt what youre looking for <a class=fontbold underline fontbold underline fontbold underline href=httpswwwtwiliocomcompanyjobsopenpositions rel=noopener noreferrer nofollow target=blank> please consider other open positions <a> <p> <p> <em> Please note this role is open to candidates outside of Colorado California New York and Washington The information below is provided for candidates hired in those locations only <em> <p> <p> The estimated pay ranges for this role are as follows <p> <ul> <li> <p> Based in Colorado $13500 $169000 <p> <li> <li> <p> This role may be eligible to participate in Twilios equity plan and corporate bonus plan All roles are eligible for the following benefits health care insurance 401k retirement account paid sick time paid personal time off paid parental leave <p> <li> <ul> <p> The successful candidates starting salary will be determined based on permissible nondiscriminatory factors such as skills experience and geographic location within the state <p> <p> <strong> Twilio is proud to be an equal opportunity employer <strong> Twilio is proud to be an Equal Employment Opportunity and Affirmative Action employer We do not discriminate based upon race religion color national origin sex including pregnancy childbirth reproductive health decisions or related medical conditions sexual orientation gender identity gender expression age status as a protected veteran status as an individual with a disability genetic information political views or activity or other applicable legally protected characteristics We also consider qualified applicants with criminal histories consistent with applicable federal state and local law Additionally Twilio participates in the EVerify program in certain locations as required by law <p> <p> Twilio is committed to providing reasonable accommodations for qualified individuals with disabilities and disabled veterans in our job application procedures If you need assistance or an accommodation due to a disability please contact us at accommodationtwiliocom <p><p>
Lifecycle Growth Manager
Company: Grow Therapy
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> <strong> What Youll Be Doing <strong> <p> <p> As the Lifecycle Growth Manager you will develop and implement growth strategies optimize customer lifecycle engagement and collaborate with crossfunctional teams to drive customer acquisition and retention Your responsibilities will include <p> <ul> <li> <p> <strong> Optimizing Automated Communication Campaigns <strong> You will be responsible for optimizing email SMS and other automated communication campaigns to drive engagement and retention This includes analyzing data to identify areas for improvement AB testing different messaging strategies and implementing personalized communication tactics They <em> must have expertise <em> in email deliverability and SMSemail compliance requirements <p> <li> <li> <p> <strong> Running and Improving the Provider Referral Program <strong> You will oversee and enhance the provider referral program leveraging it as a key driver of growth This will involve identifying opportunities to optimize the referral program creating incentives and rewards for providers and tracking the effectiveness of referral campaigns <p> <li> <li> <p> <strong> Implementing ProductDriven Initiatives <strong> You will work closely with the product team to identify and implement growth initiatives that are driven by product enhancements This may include developing strategies for productled growth analyzing user behavior data to inform product improvements implementing triggersevents for marketing automation and collaborating with crossfunctional teams to execute these initiatives <p> <li> <li> <p> <strong> Analyzing Data and Conducting Experiments <strong> You will utilize your strong background in data analysis to identify areas in the customer lifecycle that have the greatest impact on growth You will develop and execute experiments to optimize these areas measuring the success of different strategies and iterating based on datadriven insights <p> <li> <li> <p> <strong> Collaborating with Sales Product and Growth Teams <strong> As a Growth Manager you will collaborate closely with various teams including sales product and growth You will work together to align growth strategies share insights and learnings and drive growth and engagement across all stages of the customer lifecycle <p> <li> <li> <p> <strong> Monitoring and Reporting Key Performance Indicators KPIs <strong> You will be responsible for monitoring and reporting on key performance indicators KPIs that positively influence customer behavior throughout the marketing cycle This includes tracking and analyzing metrics related to engagement evaluation purchase onboarding and retention <p> <li> <ul> <p> Salary range $116000 $140000 <p> <p> <p> <p> <strong> Youll Be a Good Fit If <strong> <p> <ul> <li> <p> You have experience with emailSMS marketing productled growth and referral programs <p> <li> <li> <p> You possess a strong background in data analysis and customer segmentation <p> <li> <li> <p> Experience with using marketing automation software to engage a large consumer base Braze Iterable Customer IO etc <p> <li> <li> <p> Expert knowledge of email deliverability and SMSEmail compliance requirements <p> <li> <li> <p> Youre skilled in marketing automation building out event triggers with product teams <p> <li> <li> <p> Excellent written communication skills for both communicating internally but also with our customers <p> <li> <li> <p> You have a proven track record of successful project management and crossfunctional collaboration <p> <li> <li> <p> Youre passionate about customer acquisition and retention and are driven to achieve growth objectives <p> <li> <ul> <p> <em> If you dont meet every single requirement but are still interested in the job please apply Nobody checks every box and Grow believes the perfect candidate is more than just a resume <em> <p> <p> Note Please upload your resume in PDF format <p><p>
Program Manager
Company: Nuna
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <h2> YOUR TEAM <h2> <p> Nunas products are built to help deliver valuebased care at scale across the United States healthcare system Valuebased healthcare is a delivery model where providers are paid based on patient health outcomes instead of traditional fee for service arrangements driving delivery of higher quality care for patients at lower cost Today valuebased care is incredibly difficult to operationalize so were making it easier with products that enable automated accurate and transparent operation of valuebased payments <p> <p> Nunas Customer Solutions and Delivery teams are forwarddeployed partnerfocused teams dedicated to the efficient delivery of our ValueBased Payment suite to partners changing the face of healthcare in the United States <p> <p> Program Managers partner with the Implementation team to ensure each partner implementation runs smoothly across workstreams and partners Their excellent communication and organizational skills allow them to easily navigate both external partners and internal team relationships They help our subject matter experts software engineers and data analysts focus on the most critical tasks of an implementation They track details motivate teams and maintain consensus to ensure we deliver timely quality implementations <p> <h2> YOUR OPPORTUNITIES <h2> <ul> <li> <p> Coordinate crossteam work and createmaintain release plans <p> <li> <li> <p> Navigate crossfunctional teams of 30+ people to drive ownership and delivery <p> <li> <li> <p> Attend partnerspecific internal and external meetings to document and track action items <p> <li> <li> <p> Manage monthly data updates and be a pointcontact for partnerrelated data update status communications <p> <li> <li> <p> Support updates to code and data release internal documents workbooks trackers etc <p> <li> <li> <p> Address risks and enforce standards across the standard delivery lifecycle from planning and analysis through testing and deployments <p> <li> <li> <p> Manage internal risks external risks and dependencies <p> <li> <ul> <h2> QUALIFICATIONS <h2> <p> Required Qualifications <p> <ul> <li> <p> 2 years of work experience in healthcare technology preferably in support of health plans and valuebased payment arrangements <p> <li> <li> <p> Experience working in a nimble agile environment <p> <li> <li> <p> Experience supporting UAT processes <p> <li> <li> <p> Excellent written and verbal communication skills <p> <li> <li> <p> Keen problem solving abilities <p> <li> <li> <p> An extremely organized and detailoriented approach to work <p> <li> <ul> <p> Preferred Qualifications <p> <ul> <li> <p> PMP Certified <p> <li> <li> <p> PMIACP Certified or similar <p> <li> <li> <p> Experience working in a technical product environment <p> <li> <li> <p> Experience working in healthcare preferable in a Value Based Care setting <p> <li> <li> <p> Ability to summarize critical tasks and actions items and effectively communicate in written and verbal form to stakeholders <p> <li> <li> <p> Ability to work cross functionally with both internal and external stakeholders <p> <li> <ul> <p> We take into account an individuals qualifications skillset and experience in determining final salary This role is eligible for health insurance life insurance retirement benefits participation in the companys equity program paid time off including vacation and sick leave The expected salary range for this position is $95000 to $110000 The actual offer will be at the companys sole discretion and determined by relevant business considerations including the final candidates qualifications years of experience and skillset <p> <p> LINP1 LIRemote <p><p>
Senior Backend Engineer - Styles
Company: Webflow
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> At Webflow our mission is to bring development superpowers to everyone Webflow is the leading visual development platform for building powerful websites without writing code By combining modern web development technologies into one platform Webflow enables people to build websites visually saving engineering time while clean code seamlessly generates in the background From independent designers and creative agencies to Fortune 500 companies millions worldwide use Webflow to be more nimble creative and collaborative Its the web made better <p> <p> The Styles team is responsible for building and investing in the design capabilities of our core product to empower millions of designers worldwide to easily adopt Webflow to build manage and scale any number of sites efficiently <p> <p> Were looking for a Senior Backend Engineer to join the Styles team and lead the team to deliver impactful features for our customers to build highly personalized web experiences In this role you will execute the technical direction and be a mentor amp partner to other engineers on the team Additionally you will help lead crossfunctional efforts to drive even greater impact <p> <h2> <strong> About the role <strong> <h2> <ul> <li> <p> Location Remotefirst United States BC amp ON Canada <p> <li> <li> <p> Fulltime <p> <li> <li> <p> Permanent <p> <li> <li> <p> Exempt US Candidates <p> <li> <li> <p> Reporting to the Engineering Manager of Designer UX team <p> <li> <li> <p> The cash compensation for this role is tailored to align with the cost of labor in different geographic markets Weve structured the base pay ranges for this role into zones for our geographic markets and the specific base pay within the range will be determined by the candidates geographic location jobrelated experience knowledge qualifications and skills <p> <ul> <li> <p> Zone A $162500 $216050 <p> <li> <li> <p> Zone B $152700 $203100 <p> <li> <li> <p> Zone C $143000 $190150 <p> <li> <ul> <ul> <li> <p> CAD 184600 CAD 245500 <p> <li> <ul> <ul> <li> <p> United States all figures cited below in USD and pertain to workers in the United States <p> <li> <li> <p> Canada All figures cited below in CAD and pertain to workers in ON amp BC Canada <p> <li> <ul> <li> <ul> <p> Please visit our <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowaboutwebflowiocareers rel=noopener noreferrer nofollow target=blank> Careers page <a> for more information on which locations are included in each of our geographic pay zones However please confirm the zone for your specific location with your recruiter <p> <p> As a Senior Backend Engineer youll <p> <ul> <li> <p> Design and implement scalable backend services <p> <li> <li> <p> Drive crosspillar collaboration with software engineers product managers designers and QA analysts in an autonomous supportive team environment <p> <li> <li> <p> Effectively communicate team priorities and strategy to engineering and crossfunctional leadership teams <p> <li> <li> <p> Build and maintain unit and integration tests <p> <li> <li> <p> Provide clarity on processes and priorities to crosspillar partners and other engineers on the team <p> <li> <li> <p> Mentor other engineers on best practices code design considerations and quality <p> <li> <ul> <p> In addition to the responsibilities outlined above at Webflow we will support you in identifying where your interests and development opportunities lie and well help you incorporate them into your role <p> <h2> <strong> About you <strong> <h2> <p> Youll thrive as a Senior Backend Engineer Styles if you <p> <ul> <li> <p> Have 5+ years of experience in scalable multitenant environments <p> <li> <li> <p> Have 2+ years experience working with feature teams on customerfacing products shipping and iterating to solve customer problems <p> <li> <li> <p> Value testing and documentation equally as much as your code <p> <li> <li> <p> Are comfortable with ambiguity and scoping solutions with your teammates <p> <li> <li> <p> Are comfortable working on JavascriptTypescript MongoDB and Node <p> <li> <li> <p> Have consistently communicated trade offs throughout a project to meet both technical and business requirements <p> <li> <li> <p> Enjoy highvisibility work and presenting to executive counterparts <p> <li> <li> <p> Get excited about encouraging and developing other engineers <p> <li> <ul> <p> Even if you dont meet 100 of the above qualifications you should still seriously consider applying Research shows that you may still be considered for a role if you meet just half of the requirements <p> <p> <strong> Our Core Behaviors <strong> <p> <ul> <li> <p> <strong> Obsess over customer experience <strong> We deeply understand what were building and who were building for and serving We define the leading edge of whats possible in our industry and deliver the future for our customers <p> <li> <li> <p> <strong> Move with heartfelt urgency <strong> We have a healthy relationship with impatience channeling it thoughtfully to show up better and faster for our customers and for each other Time is the most limited thing we have and we make the most of every moment <p> <li> <li> <p> <strong> Say the hard thing with care <strong> Our best work often comes from intelligent debate critique and even difficult conversations We speak our minds and dont sugarcoat things and we do so with respect maturity and care <p> <li> <li> <p> <strong> Make your mark <strong> We seek out new and unique ways to create meaningful impact and we champion the same from our colleagues We work as a team to get the job done and we go out of our way to celebrate and reward those going above and beyond for our customers and our teammates <p> <li> <ul> <h3> <strong> Benefits amp wellness <strong> <h3> <ul> <li> <p> Equity ownership RSUs in a growing privatelyowned company <p> <li> <li> <p> 100 employerpaid healthcare vision and dental insurance coverage for employees and dependents fulltime employees working 30+ hours per week as well as Health Savings AccountHealth Reimbursement Account dependent care Flexible Spending Account US only dependent on insurance plan selection where applicable in the respective country of employment Employees may also have voluntary insurance options such as life disability hospital protection accident and critical illness where applicable in the respective country of employment <p> <li> <li> <p> 12 weeks of paid parental leave for both birthing and nonbirthing caregivers as well as an additional 68 weeks of pregnancy disability for birthing parents to be used before child bonding leave where local requirements are more generous employees receive the greater benefit Employees also have access to family planning care and reimbursement <p> <li> <li> <p> Flexible PTO with a mandatory annual minimum of 10 days paid time off for all locations where local requirements are more generous employees receive the greater benefit and sabbatical program <p> <li> <li> <p> Access to mental wellness and professional coaching therapy and Employee Assistance Program <p> <li> <li> <p> Monthly stipends to support health and wellness smart work and professional growth <p> <li> <li> <p> Professional career coaching internal learning amp development programs <p> <li> <li> <p> 401k plan and pension schemes in countries where statutorily required financial wellness benefits like CPA or financial advisor coverage <p> <li> <li> <p> Discounted Pet Insurance offering US only <p> <li> <li> <p> Commuter benefits for inoffice employees <p> <li> <ul> <p> <em> Temporary employees are not eligible for paid holiday time off accrued paid time off paid leaves of absence or companysponsored perks unless otherwise required by law <em> <p> <h3> <strong> Be you with us <strong> <h3> <p> At Webflow equality is a core tenet of our culture We are an Equal Opportunity EEOVeteransDisabled Employer and are <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomdiversityequityinclusion rel=noopener noreferrer nofollow target=blank> committed <a> to building an inclusive global team that represents a variety of backgrounds perspectives beliefs and experiences Employment decisions are made on the basis of jobrelated criteria without regard to race color religion sex sexual orientation gender identity national origin disability veteran status or any other classification protected by applicable law Pursuant to the San Francisco Fair Chance Ordinance Webflow will consider for employment qualified applicants with arrest and conviction records <p> <h3> <strong> Stay connected <strong> <h3> <p> Not ready to apply but want to be part of the Webflow community Consider following our story on our <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomblog rel=noopener noreferrer nofollow target=blank> Webflow Blog <a> <a class=fontbold underline fontbold underline fontbold underline href=httpswwwlinkedincomcompanywebflowinc rel=noopener noreferrer nofollow target=blank> LinkedIn <a> <a class=fontbold underline fontbold underline fontbold underline href=httpstwittercomwebflow rel=noopener noreferrer nofollow target=blank> X Twitter <a> andor <a class=fontbold underline fontbold underline fontbold underline href=httpswwwglassdoorcomReviewsWebflowReviewsE890506htm rel=noopener noreferrer nofollow target=blank> Glassdoor <a> <p> <h3> <strong> Please note <strong> <h3> <p> <em> We will ensure that individuals with disabilities are provided reasonable accommodation to participate in the job application or interview process to perform essential job functions and to receive other benefits and privileges of employment Upon interview scheduling instructions for confidential accommodation requests will be administered <em> <p> <p> <em> To join Webflow youll need a valid right to work authorization depending on the country of employment <em> <p> <p> <em> If you are extended an offer that offer may be contingent upon your successful completion of a background check which will be conducted in accordance with applicable laws We may obtain one or more background screening reports about you solely for employment purposes <em> <p> <p> <em> For information about how Webflow processes your personal information please review <em> <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomlegalapplicantprivacynotice rel=noopener noreferrer nofollow target=blank> <em> Webflows Applicant Privacy Notice <em> <a> <em> <em> <p><p>
Principal Software Engineer
Company: RapidAI
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> RapidAI is the global leader in using AI to combat lifethreatening vascular and neurovascular conditions RapidAI is empowering physicians to make faster decisions for better patient outcomes leading the next evolution of clinical decisionmaking and patient workflow Based on intelligence gained from over 10 million scans in more than 2000 hospitals in over 60 countries the Rapid® platform transforms care coordination offering care teams a level of patient visibility never before possible RapidAI where AI meets patient care <p> <p> <p> <p> <p> <p> <strong> What you will do <strong> <p> <ul> <li> <p> Design complex scalable software systems and architectures Evaluate existing architectures and propose improvements Ensure technical decisions align with product roadmap <p> <li> <li> <p> Plan technical projects and milestone deliverables in alignment with product managers Coordinate engineers and their tasks and monitor overall progress <p> <li> <li> <p> Design and build impactful technical solutions and own them through the entire development lifecycle <p> <li> <li> <p> Develop complex features and components Review code and designs developed by other engineers Debug difficult issues across the codebase <p> <li> <li> <p> Research the latest technologies and propose ways to integrate them to improve the product Come up with solutions for technical challenges and improvements <p> <li> <li> <p> Provide technical guidance and mentorship to other engineers Establish engineering best practices and standards <p> <li> <li> <p> Clearly communicate complex technical concepts and designs to both technical and nontechnical audiences Collaborate cross functionally across product program management and other teams <p> <li> <li> <p> Establish quality standards design review checklists code review processes etc Monitor system performance and ensure quality goals are met Drive continuous improvement <p> <li> <ul> <p> <p> <p> <strong> What you bring <strong> <p> <ul> <li> <p> Bachelors Degree or equivalent <p> <li> <li> <p> 12+ years of experience in software development and demonstrated engineering leadership <p> <li> <li> <p> 8+ years of experience in backend development <p> <li> <li> <p> 3+ years in using Typescript and Amazon AWS <p> <li> <li> <p> High level of skill in at least one generalpurpose backend language and one frontend language but willingness to work with other languages if required <p> <li> <li> <p> High level of distributed system design skill <p> <li> <li> <p> Creating platforms reusable libraries and utilities wherever applicable <p> <li> <li> <p> Writing highquality code that is modular functional and testable <p> <li> <li> <p> Troubleshoot issues effectively in a distributed architecture <p> <li> <li> <p> Communicate collaborate and work effectively in a global environment <p> <li> <li> <p> Solid analytical and reasoning skills for design troubleshooting and root cause analysis <p> <li> <li> <p> Great communication skills with technical and nontechnical teams <p> <li> <ul> <p> <p> <p> <strong> Bonus Skills <strong> <p> <ul> <li> <p> iOS or Android development experience Swift Kotlin and good understanding of Native mobile <p> <li> <li> <p> Experience in a regulated software environment eg medical device aerospace defense automotive <p> <li> <li> <p> Experience with DICOM HL7 or other medical data formatsprotocols <p> <li> <ul> <p> <p> <p> <strong> What we offer you <strong> <p> <ul> <li> <p> RapidAI pays 100 for employee coverage amp 75 for your dependent coverage for medical dental amp vision premiums <p> <li> <li> <p> Medical Benefits We offer a range of policies through TriNet <p> <li> <li> <p> Life InsuranceADampD is 1X times your annual salary <p> <li> <li> <p> We pay 100 for Short and Long Term Disability <p> <li> <li> <p> Healthcare and Dependent care flexible spending accounts are available <p> <li> <li> <p> A 401k plan is offered through Empower <p> <li> <li> <p> RapidAI provides $100 a month for internetcellphone services <p> <li> <ul> <p> Time Off <p> <ul> <li> <p> We have 10 company paid holidays <p> <li> <li> <p> RapidAI has a flexible vacation policy We urge employees to take vacation Vacation allows employees to renew reinvigorate and rejuvenate <p> <li> <ul> <p> Other Cool Benefits <p> <ul> <li> <p> Equity Stock Options <p> <li> <li> <p> Incentive Compensation <p> <li> <li> <p> And most importantly You are joining an awesome team <p> <li> <ul> <p> <p> <p> <p> <p> <strong> Compensation <strong> The salary range target for the role described in this job description is $200000 to $208000 Final offer amounts depend on multiple factors including but not limited to candidate experience and expertise geographic location compensationequity mix and market data This position may also be eligible for additional incentives such as equity awards shortterm incentives or sales compensation <p> <p> <p> <p> RapidAI is committed to creating an inclusive and diverse workplace We provide equal employment opportunities to all employees and applicants and prohibit discrimination and harassment of any type in regard to race color religion age sex national origin disability status genetics protected veteran status sexual orientation gender identity or expression or any other characteristic protected by federal state or local laws <p> <p> <p> <p> Please review our CPRA policies <a class=fontbold underline fontbold underline postingslink href=httpsrapidaiboxcomsbc5l0izmwcyf8mu34sbsalmzx4ly1mkl rel=noopener noreferrer nofollow target=blank> here <a> <p> <p> For more information on the information we collect about our applicants and how we use it see our CPRA Privacy Notice <a class=fontbold underline fontbold underline postingslink href=httpsrapidaiboxcomslpyfu84mmopywvcox0i4ej15c4v84ck1 rel=noopener noreferrer nofollow target=blank> here <a> <p><p>
Account Executive (Manager/Director of Strategic Accounts)
Company: OfferFit
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> <strong> Position Overview <strong> <p> <p> Were currently looking for a driven Account Executive ManagerDirector of Strategic Accounts to join our team In this role youll be responsible for winning and growing business for OfferFit by owning new and existing senior customer relationships <p> <p> <strong> In particular you will <strong> <p> <ul> <li> <p> Working closely with our business development amp marketing teams to create leads <p> <li> <li> <p> Lead discussions with potential new OfferFit customers <p> <li> <li> <p> Work with current and future OfferFit customers to determine the highestimpact applications of our AIsolution <p> <li> <li> <p> Participate in OfferFit POV motion to ensure they progress successfully working closely with OfferFits technical Implementation team <p> <li> <li> <p> Build amp own relationships with senior leaders at OfferFits customer companies eg CMOs CIOs <p> <li> <li> <p> Communicate customer needs to OfferFits product amp marketing teams ensuring a customercentric product roadmap <p> <li> <ul> <p> <strong> Why is it great <strong> <p> <ul> <li> <p> Be the face of the company working alongside our customers to help them succeed <p> <li> <li> <p> Sell a product with strong productmarket fit the pain of manual experimentation is a real pain point for marketers leading to a high level of enthusiasm for our products <p> <li> <li> <p> Get strong support from leadership OfferFit prioritizes sales helping your team succeed will be a true priority for the CEO and other Sales leadership team members <p> <li> <li> <p> Lead the AI transformation happening in marketing technology today OfferFit is at the forefront so youll be in the middle of the action <p> <li> <li> <p> Join OfferFits fastpaced supportive and professional team We make sure all of our team members are empowered and receive great mentorship and coaching <p> <li> <ul> <p> <strong> Whos a fit <strong> <p> <ul> <li> <p> Executionfocused leader you can structure a plan align stakeholders and see it through to execution <p> <li> <li> <p> People person you build trustbased relationships with internal team members and external partners and combine empathy with a willingness to have direct challenging conversations <p> <li> <li> <p> Processdriven you can create scalable frameworks to optimize the success of business outcomes <p> <li> <li> <p> Entrepreneurial you take initiative work around obstacles and always seek creative ways to get to the next level <p> <li> <li> <p> Technology enthusiast you are passionate about new technologies and their potential to impact businessasusual <p> <li> <li> <p> Clear communicator you are able to express yourself clearly and persuasively both in writing and speech <p> <li> <li> <p> Sales expert you have a history of enterprise sales and are wellversed in SPIN selling amp MEDDPICC qualification methodology <p> <li> <ul> <p> The base salary range for this position in the United States is $81000$142000 per year plus eligibility for additional commissionbonus ranging $91000$162000 with an overall OTE of $172000$305000 ability to earn more based on sales goals Eligibility for an additional end of year performance bonus commissions when applicable andor equity options may be provided as part of the compensation package in addition to a full range of medical financial andor other benefits depending on the position offered For nonUS based candidates base pay and overall compensation packages will be adjusted based on location Applicants should apply via OfferFits internal or external careers site <p> <p> <strong> OfferFit Benefits and Perks <strong> <p> <ul> <li> <p> Generous PTO starting at 25 days PTO per year and Parental leave policy 12 weeks paid <p> <li> <li> <p> 100 remote work environment with flexible hours <p> <li> <li> <p> Quarterly gatherings where we meet in person in a different city to work together bond as a team and celebrate our progress <p> <li> <li> <p> Weekly team events lunch and learns trivia virtual escape rooms town hall and team health barometer meetings <p> <li> <li> <p> Ability to learn and develop from an experienced leadership team exAmazon McKinsey BCG and IBM among others who are focused on building a talented diverse and inclusive tea <p> <li> <li> <p> Dedication to building a strong culture eg team resource groups weekly recognitions major life event celebrations mental healthsustainability days off etc <p> <li> <li> <p> US Only Competitive benefits major medical vision dental and LTD and 401K matching program <p> <li> <ul><p>