Open Continuous Announcement Jobs in USA
392,680 open positions · Updated daily
Looking for Open Continuous Announcement jobs in USA? Browse our curated listings with transparent salary information to find the perfect Open Continuous Announcement position in the USA area.
Client Development Director - Channel Partnerships
Company: StackAdapt
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> StackAdapt is a selfserve advertising platform that specializes in multichannel solutions including native display video connected TV audio ingame and digital outofhome ads We empower hundreds of digitallyfocused companies to deliver outcomes and exceptional campaign performance everyday StackAdapt was founded with a vision to be more than an advertising platform its a hub of innovation imagination and creativity <p> <p> <p> <p> Are you a proactive problem solver with a passion for programmatic advertising Are you a relationship builder with strong interpersonal communication skills If so then we want to hear from you Were looking for a Client Development Manager to join our expanding Channel Partnerships team in a specialist capacity <p> <p> <p> <p> You will become a foremost expert on the StackAdapt platform while owning the growth and success of enterprise level channel partners post sale The ideal candidate will manage a group of accounts with the goal of exceeding StackAdapts customer success standards building valuable relationships across executive and operator levels and driving new business using a consultative partner based sales approach <p> <p> <p> <p> Successful candidates will be self motivated with a strong track record of quickly understanding client technical needs and business objectives to recommend the right solutions to achieve goals <p> <p> <p> <p> StackAdapt is a Remote First company we are open to candidates located anywhere in the US for this position <p> <p> <p> <p> <p> <p> <strong> What youll be doing <strong> <p> <ul> <li> <p> Act as StackAdapts principle evangelist media thought leader problem solver and point of contact across your account portfolio <p> <li> <li> <p> Accurately forecast business needs and account growth while maintaining a clean pipeline of incremental opportunities <p> <li> <li> <p> Own build and run the rhythm of business across your portfolio through the use of status calls strategy calls office hours QBRs and more <p> <li> <li> <p> Identify and pitch key incremental sales opportunities develop client enablement plans and work cross functionally within StackAdapt to solve client needs and develop new opportunities <p> <li> <ul> <p> <p> <p> <strong> What youll bring to the table <strong> <p> <ul> <li> <p> High level of experience managing enterprise clients within the programmatic advertising space preferably at a Demand Side Platform Trading Desk or Media Agency <p> <li> <li> <p> Comfortable working within a quota based environment with a track record of exceeding targets and successfully growing account portfolios <p> <li> <li> <p> Positive energy proactive mentality highly organized with a growth mindset <p> <li> <li> <p> Bonus if you have worked with API based media clients at a Demand Side Platform <p> <li> <ul> <p> <p> <p> <strong> StackAdapters Enjoy <strong> <p> <ul> <li> <p> Competitive salary + commissions <p> <li> <li> <p> 401K matching <p> <li> <li> <p> 3 weeks vacation + 3 personal care days + 1 Culture amp Belief day + birthdays off <p> <li> <li> <p> Access to a comprehensive mental health care platform <p> <li> <li> <p> Health benefits from day one of employment <p> <li> <li> <p> Work from home reimbursements <p> <li> <li> <p> Optional global WeWork membership for those who want a change from their home office <p> <li> <li> <p> Robust training and onboarding program <p> <li> <li> <p> Coverage and support of personal development initiatives conferences courses etc <p> <li> <li> <p> Access to StackAdapt programmatic courses and certifications to support continuous learning <p> <li> <li> <p> Mentorship opportunities with industry leaders <p> <li> <li> <p> An awesome parental leave policy <p> <li> <li> <p> A friendly welcoming and supportive culture <p> <li> <li> <p> Our social and team events <p> <li> <ul> <p> <p> <p> <p> <p> <p> <p> <p> <p> <em> StackAdapt is a diverse and inclusive team of collaborative hardworking individuals trying to make a dent in the universe No matter who you are where you are from who you love follow in faith disability or superpower status ethnicity or the gender you identify with if youre comfortable let us know your pronouns you are welcome at StackAdapt If you have any requests or requirements to support you throughout any part of the interview process please let our Talent team know <em> <p> <p> <p> <p> <strong> About StackAdapt <strong> <p> <p> <p> <p> Weve been recognized for our diverse and supportive workplace high performing campaigns awardwinning customer service and innovation Weve been awarded <p> <p> <p> <p> <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpsblogstackadaptcomstackadaptnamedadagesbestplacetowork2024utmsource=linkedinamputmmedium=organicsocialamputmcampaign=adagesbestplacetowork2024amputmcontent=blog rel=noopener noreferrer nofollow target=blank> Ad Age Best Places to Work 2024 <a> <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpsblogstackadaptcomg22024bestsoftwareawards rel=noopener noreferrer nofollow target=blank> G2 Top Software and Top Marketing and Advertising Product for 2024 <a> <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpsblogstackadaptcom2023bestplacestoworkuk rel=noopener noreferrer nofollow target=blank> Campaigns Best Places to Work 2023 for the UK <a> <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpsblogstackadaptcombestworkplacesforwomenlist rel=noopener noreferrer nofollow target=blank> 2024 Best Workplaces for Women <a> and <a class=fontbold underline fontbold underline postingslink href=httpsblogstackadaptcom2023bestworkplacesincanadalist rel=noopener noreferrer nofollow target=blank> in Canada <a> by Great Place to Work® <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpswwwg2comproductsstackadaptreviews rel=noopener noreferrer nofollow target=blank> 1 DSP on G2 and leader in a number of categories including CrossChannel Advertising <a> <p> <p> <p> <p> LIRemote <p><p>
Senior Director of Integrated Media
Company: Code.org
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <h2> <strong> JOB SUMMARY <strong> <h2> <p> The Senior Director of Media will lead the strategic direction and execution of all paid earned and owned media initiatives to elevate Codeorgs brand and mission This role is responsible for crafting highimpact media strategies that effectively reach target audiences managing media budgets to ensure maximum ROI and forging strategic partnerships to enhance our media presence <p> <h2> <strong> DUTIES AND RESPONSIBILITIES <strong> <h2> <p> Integrated Media Strategy <p> <ul> <li> <p> Develop and execute a unified media strategy that seamlessly integrates paid earned and owned channels ensuring consistent messaging and optimal audience engagement across all platforms to amplify Codeorgs mission and organizational goals <p> <li> <li> <p> Establish and nurture strategic connections and partnerships with media platforms agencies and other relevant organizations to unlock new media opportunities and collaborations <p> <li> <li> <p> Stay at the forefront of media trends and technological advancements adapting and innovating media strategies to maintain competitiveness and relevance in the digital landscape <p> <li> <li> <p> Collaborate closely with marketing and creative teams to ensure seamless integration of media plans with broader marketing campaigns and content strategies <p> <li> <ul> <p> Paid Media Leadership <p> <ul> <li> <p> Focus on strategically investing in paid media channels to target specific audiences enhance visibility and drive measurable outcomes Utilize datadriven insights to allocate budgets effectively continuously optimizing campaigns for maximum ROI <p> <li> <li> <p> Strategically leverage existing partnerships to maximize opportunities for grants and PSAs ensuring optimal placement and exposure to support Codeorgs mission and amplify its impact on a larger scale <p> <li> <ul> <p> Earned Media Leadership <p> <ul> <li> <p> Maximize earned media opportunities through compelling storytelling media relations and influencer partnerships Aim to amplify Codeorgs visibility and credibility by securing coverage and endorsements that resonate with our mission and values <p> <li> <li> <p> Work collaboratively with partners to cocreate and launch impactful campaigns that align with mutual objectives driving increased engagement and support for educational initiatives <p> <li> <ul> <p> Owned Media Leadership <p> <ul> <li> <p> Implement a dynamic social media strategy across Codeorgs platforms to engage audiences share insights and foster community Oversee the social media community management team ensuring active social discussions and participation while maintaining a welcoming environment <p> <li> <li> <p> Enhance Codeorg executives online presence through strategic use of speaking engagements and social media positioning them as key voices in computer science education Oversee the event execution team ensuring all events align with our mission and enhance our objectives <p> <li> <ul> <p> Media Reporting and Analysis <p> <ul> <li> <p> Define clear measurable key performance indicators KPIs tailored to each campaigns objectives ensuring alignment with overall business goals <p> <li> <li> <p> Develop comprehensive media reporting frameworks to track campaign performance across all channels utilizing data analytics to provide actionable insights and detailed postcampaign analysis for continuous improvement <p> <li> <li> <p> Implement ongoing optimization strategies based on realtime data adjusting media placements channel focus and budget allocation to enhance campaign performance and maximize return on investment ROI <p> <li> <li> <p> Establish learning agendas for all major campaigns to test hypotheses and new strategies fostering a culture of innovation and ensuring the media strategy evolves with changing market dynamics <p> <li> <ul> <p> Media Operations Efficiency <p> <ul> <li> <p> Streamline media operations to enhance campaign execution and delivery ensuring seamless integration of planning buying and realtime adjustments across all media channels <p> <li> <li> <p> Oversee the precise trafficking of advertising materials coordinating with creative and media teams to ensure ads are correctly formatted targeted and delivered on schedule <p> <li> <ul> <h2> <strong> EXPERIENCE amp QUALIFICATIONS <strong> <h2> <p> We seek candidates who have <p> <ul> <li> <p> Bachelors degree in Marketing Advertising Communications or a related field <p> <li> <li> <p> Minimum of 10 years of experience in media planning and buying with a significant focus on paid media strategies and execution <p> <li> <li> <p> Proven track record of developing and managing largescale media campaigns that have delivered measurable results <p> <li> <li> <p> Strong analytical skills with expertise in ROI analysis and media metrics <p> <li> <li> <p> Exceptional negotiation and relationshipbuilding skills <p> <li> <ul> <p> We prefer candidates who also have <p> <ul> <li> <p> Experience in the nonprofit or education sector <p> <li> <li> <p> Familiarity with global media strategies and multimarket campaigns <p> <li> <li> <p> Leadership experience with the ability to inspire and guide a team towards achieving shared goals <p> <li> <ul> <p> In addition candidates must <p> <ul> <li> <p> Be a US Citizen or Permanent Resident <p> <li> <li> <p> Pass a preemployment background check <p> <li> <li> <p> Be willing to travel a minimum of two times per year for team events <p> <li> <ul> <p> <p> <h2> <strong> WHAT IS THE INTERVIEW PROCESS LIKE <strong> <h2> <p> Step 1 Informational Interview learn more about the role and share your experience 30 minutes <p> <p> Step 2 Homework ~3 hours <p> <p> Step 3 Interviews with several members of the Codeorg team ~ 3 hours <p> <p> Step 4 Final Interview 1hour <p> <p> Step 5 Reference Checks <p> <p> <u> <em> All interviews are currently being conducted virtually via Zoom <em> <u> <p> <p> <p> <h2> <strong> TO APPLY <strong> <h2> <p> The priority application date for this role is <strong> March 8 2024 <strong> and preference will be given to applications submitted by this date Our team will review all applications and if we believe your qualifications would make a great fit well contact you to schedule an informational interview <p> <h2> <strong> COMPENSATION amp BENEFITS PACKAGE <strong> <h2> <p> The expected salary range for this position is $150000$170000 The actual offer will be at the companys sole discretion and determined by relevant business considerations including the final candidates qualifications years of experience and skillset <p><p>
Research Associate - siRNA/Peptides + Antibody
Company: Vial
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> <strong> Who We Are <strong> <p> <p> <p> <p> Vial is a global techdriven CRO providing nextgeneration clinical trial management services The Vial CRO powers its drug discovery arm Battery Bio an AIpowered hyper scalable biotech Battery Bio harnesses Vials unique 90 lower cost structure to produce more affordable drug development with efficient streamlined clinical trials <p> <p> <p> <p> Our mission is to reimagine the drug discovery process to empower scientists to cure all human disease We have assembled a talented team of clinical operators chemists and innovative thinkers to achieve this vision <p> <p> <p> <p> Vial is a San Francisco Californiabased company founded by Simon Burns in October 2020 Since our founding we have become a fastgrowing company of 100+ employees with over $100 million in funding from esteemed investors including General Catalyst Box Group and Byers Capital <p> <p> <p> <p> Vial is rebuilding the infrastructure to advance research By deploying technology at every step we are creating a more efficient future for drug discovery <p> <p> <p> <p> <strong> What Youll Do <strong> <p> <p> Work in a structurebased computationally driven drug discovery paradigm <p> <p> Iteratively scale rethink and collaborate on a drug discovery engine that will scale to hundreds of programs <p> <p> Work on assay development and process development for Vials in house discovery efforts <p> <p> Research new modalities + new approaches and serve as a thought partner to the team <p> <p> Work with other scientists clinicians computational biologists project managers and external partners to accomplish our mission of curing diseases <p> <p> <p> <p> <strong> What Youll Bring <strong> <p> <p> 35 years of experience in Antibody discoveryprogram development or roles directly related to the Research amp Development of antibody programs <p> <p> Entrepreneurial mindset experience in startup environment preferred a plus <p> <p> Deeply analytical systems thinker focused on finding scalable solutions <p> <p> <p> <p> <p> <p> <p> <p> $90000 $110000 a year <p> <p> <strong> Why Youll Love Working At Vial <strong> <p> <p> <p> <p> <strong> We are innately curiosity <strong> We found our calling in clinical trials after learning the pain points directly It is our curiosity that propels us to keep building finding new challenges and fulfilling our vision of reimagining clinical trials <p> <p> <strong> We believe in autonomy <strong> Team members do their best work when given autonomy In order to make an impact on the scale of the Vial vision we built our culture to enable each Vial team member to feel ownership of their domain <p> <p> <strong> We take pride in building mastery <strong> We believe in building master in a craft Craftsmanship a pride in ones craft is key to prolonged engagement on a difficult challenge Vials culture is one of highly autonomous deeply focused experts working on an immensely hard problem together <p> <p> <strong> Our strength is moving fast and staying humble <strong> We believe that if we build a team that is intellectually honest that we stay nimble and keep an open mind to all solutions well be adaptive and solve the problems that face us at every turn <p> <p> <p> <p> <strong> Benefits <strong> <em> Not applicable to Contract or Temp Positions <em> <p> <p> Competitive Equity Compensation <p> <p> Comprehensive benefits package including Medical Dental and Vision insurance <p> <p> 401k or RRSP Plan with Company Matching after first 90 days of employment <p> <p> One time Remote Office Setup Stipend <p> <p> Paid Parental Leave <p> <p> RemoteFirst Flexible Work Schedule <p> <p> Unlimited Vacation <p> <p> <p><p>
Director - Corporate FP&A
Company: Icertis
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> With unmatched technology and categorydefining innovation Icertis pushes the boundaries of whats possible with contract lifecycle management CLM The AIpowered analystvalidated Icertis Contract Intelligence ICI platform turns contracts from static documents into strategic advantage by structuring and connecting the critical contract information that defines how an organization runs Today the worlds most iconic brands and disruptive innovators trust Icertis to fully realize the intent of their combined 10 million contracts worth more than $1 trillion in 40+ languages and 93 countries <p> <p> <p> <p> <strong> Who we are <strong> Icertis is the only contract intelligence platform companies trust to keep them out in front now and in the future Our unwavering commitment to contract intelligence is grounded in our FORTE valuesFairness Openness Respect Teamwork and Executionwhich guide all our interactions with employees customers partners and stakeholders Because in our mission to be the contract intelligence platform of the world we believe how we get there is as important as the destination <p> <p> <p> <p> As the Director of FPampA you will play a critical leadership role you will work closely with all of companys functional leaders and bring key market strategic and operational insights that will shape the direction of the company and accelerate its growth You will also play a key role in telling the companys financial story to investors <p> <p> <p> <p> The ideal candidate will have a proven trackrecord of driving business outcomes through keen financial insight and business modeling They will have the ability to create a 360degree financial picture of the business that reflects and influences the companys strategy and be excellent at communicating with senior leaders and executives They will be toolsavvy with experience in creating scalable data and reporting solutions that support a datadriven culture LIRS1 <p> <p> <p> <p> <p> <p> <strong> What you will do <strong> <p> <ul> <li> <p> Formulate a robust 360degree financial picture of the business complete with market insights and operational drivers <p> <li> <li> <p> Develop and maintain the 3year Strategic Planning Model and forecast <p> <li> <li> <p> Deliver Global PampL and cash flow forecasts <p> <li> <li> <p> Drive Annual Planning Process work cross functionally to build and maintain the Annual Financial Plan and Departmental Budgets <p> <li> <li> <p> Build and deliver Business Performance ReportingOperating dashboards <p> <li> <li> <p> Perform strategic business analysis as needed MampA Geo Expansion <p> <li> <li> <p> Prepare financial analyses as needed to help drive improvements in the business Current focus areas include market expansion opportunities competitive benchmarking analyses pricing and strategic financial optimization strategies <p> <li> <li> <p> Partner with Controller to enhance and accelerate the financial reporting process <p> <li> <li> <p> Identifies and implements system and process improvements to increase the efficiency and effectiveness of planning and reporting workflows <p> <li> <li> <p> Prepare communications to Board of Directors <p> <li> <li> <p> Drive investor presentations and supporting analysis <p> <li> <li> <p> Develop a deep understanding of the business metrics with an eye towards understanding the benefits and risks from a financial perspective and helping to manage key business drivers and desired outcomes <p> <li> <li> <p> Play a key role in preparation of critical public financial documents to support the IPO process including working with bankers and supporting the production of investor materials and SEC filings eg S1 <p> <li> <ul> <p> <p> <p> <strong> What you will bring <strong> <p> <ul> <li> <p> 12+ years of experience of working in direct strategic analysis support of all aspects of the business at all areas of the PampL <p> <li> <li> <p> MBACPA or equivalent experience preferred <p> <li> <li> <p> Demonstrated complex modeling experience this is a handson role and managers are expected to directly contribute and lead by example <p> <li> <li> <p> Highly analytical detailoriented with a commitment to creating a highquality product Naturally inquisitive and able to extract information from various sources to identify and understand the underlying issue Not afraid to question results <p> <li> <li> <p> Prior success working in a fastpaced entrepreneurial environment takes initiative and works independently <p> <li> <li> <p> Working knowledge of accounting principles required including revenue recognition amortization and accrual vs cash accounting Must have a general understanding of financial statements <p> <li> <li> <p> Must have exceptional written visual and spoken communication skills <p> <li> <li> <p> Experience in preparing and delivering executive board and investor level communications <p> <li> <li> <p> IPO experience is a plus <p> <li> <li> <p> Must have advanced Excel Netsuite and Powerpoint skills <p> <li> <li> <p> Experience implementing financial analysis and planning tools required <p> <li> <ul> <p> <p> <p> <p> <p> $146000 $219000 a year <p> <p> <em> Pay offered will vary based on jobrelated factors such as location experience training skills and abilities In addition to the base salary and annual bonus target and an equity component is included in the compensation package <em> <p> <p> <strong> What we offer <strong> <p> <p> We are committed to the health and wellbeing of all Icertians their families the communities they live in and our customers This commitment is represented in the Icertis Four Rings of Responsibility Take Care of Self Take Care of Family Take Care of Community and Take Care of Business in that order <p> <p> <p> <p> To support these commitments Icertis offers excellent health and welfare benefits a generous 401k match and a robust paid time off program Here are some of the other reasons <a class=fontbold underline fontbold underline postingslink href=httpswwwicertiscomcompanynewsicertisplacesfirstinwashingtons100bestcompaniestoworkfor rel=noopener noreferrer nofollow target=blank> Icertis Places First in Washingtons 100 Best Companies to Work For | Icertis <a> <p> <p> <p> <p> ● Equity RSUs and shared ownership in the company <p> <p> ● Flexible work environment <p> <p> ● Paid maternity and paternity leave <p> <p> ● 7 Days for Humanity 7 paid volunteer days <p> <p> ● Generous holidays including the 4th of July week off paid <p> <p> ● Free professional and leadership coaching <p> <p> ● Annual personal development allowance <p> <p> <p> <p> Icertis Inc provides Equal Employment Opportunity to all employees and applicants for employment without regard to race color religion gender identity or expression sex sexual orientation national origin age disability genetic information marital status amnesty or status as a covered veteran in accordance with applicable federal state and local laws Icertis Inc complies with applicable state and local laws governing nondiscrimination in employment in every location in which the company has facilities If you are in need of accommodation or special assistance to navigate our website or to complete your application please send an email with your request to <a class=fontbold underline fontbold underline postingslink href=mailtocareersicertiscom rel=noopener noreferrer nofollow target=blank> careersicertiscom <a> or get in touch with your recruiter <p> <p> <p> <p> By submitting your application you acknowledge that you have read Icertiss Privacy Policy <a class=fontbold underline fontbold underline postingslink href=httpswwwicertiscomprivacystatement rel=noopener noreferrer nofollow target=blank> httpswwwicertiscomprivacystatement <a> <p> <p> <p> <p> Icertis is not open to third party solicitation or resumes for our posted FTE positions Resumes received from third party agencies that are unsolicited will be considered complimentary <p><p>
Sr. Manager Customer Success Operations
Company: Vercel
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <h2> About Vercel <h2> <p> Vercels Frontend Cloud provides the developer experience and infrastructure to build scale and secure a faster more personalized web Customers like Under Armour eBay The Washington Post Johnson amp Johnson and Zapier use Vercel to build dynamic user experiences on the web <p> <p> At Vercel our mission is to enable the world to ship the best products and that goes hand in hand with creating an environment where you can do the best work of your life <p> <h2> <strong> About the Role <strong> <h2> <p> The Senior Manager Customer Success Operations is a crucial support role for our customer success leadership and team Responsibilities include developing and maintaining systems processes and analysis to gauge customer health enhance team efficiency and identify strategies for longterm Net Dollar Retention NDR growth If you excel in optimizing operations and leveraging data for strategic insights this role is an exciting opportunity to drive customer success and contribute to sustained business growth <p> <h2> <strong> What You Will Do <strong> <h2> <ul> <li> <p> Advise and partner with Customer Success leaders leveraging insights and analytics to refine and advance our gotomarket strategy <p> <li> <li> <p> Oversee and analyze key operational metrics within the Customer Success team to drive continuous improvement and decisionmaking <p> <li> <li> <p> Drive accurate forecasting of renewals and expansions implement strategies and processes to better predict performance <p> <li> <li> <p> Lead the the selection and refinement of tools systems and processes that empower the Customer Success team to deliver impactful customer outcomes effectively <p> <li> <li> <p> Design and deploy systems and programs to support the timely delivery and billing of Professional Services <p> <li> <li> <p> Create and deploy initiatives to improve the effectiveness and efficiency of the Customer Support organization <p> <li> <li> <p> Develop and deliver strategic programs to improve our high CSAT and NPS scores in line with our commitment to bestinclass customer service <p> <li> <ul> <h2> <strong> About You <strong> <h2> <ul> <li> <p> 5+ years of experience leading Customer Success Operations or GTM Operations teams at Saas companies <p> <li> <li> <p> Demonstrated experience leading customer success field teams Customer Success Managers Account Management Professional Services Solution Architects <p> <li> <li> <p> Proven track record of designing implementing and optimizing automated customer success workflows <p> <li> <li> <p> Experience using data and metrics to drive improvements <p> <li> <li> <p> Strong verbal and written skills with a passion for documentation <p> <li> <ul> <h2> Benefits <h2> <ul> <li> <p> Great compensation package and stock options <p> <li> <li> <p> Inclusive Healthcare Package <p> <li> <li> <p> Learn and Grow we provide mentorship and send you to events that help you build your network and skills <p> <li> <li> <p> Flexible Time Off Flexible vacation policy with a recommended 4weeks per year and paid holidays <p> <li> <li> <p> Remote Friendly Work with teammates from different time zones across the globe <p> <li> <li> <p> We will provide you the gear you need to do your role and a WFH budget for you to outfit your space as needed <p> <li> <ul> <p> The San Francisco CA pay range for this role is $16700000 $20000000 This salary range is an estimate Actual salary will be based on job related skills experience and location Pay ranges outside San Francisco may be adjusted based on employee location The total compensation package also includes benefits and equitybased compensation Your recruiter can share more about the specific pay range for your location during the hiring process <p> <p> Vercel is committed to fostering and empowering an inclusive community within our organization We do not discriminate on the basis of race religion color gender expression or identity sexual orientation national origin citizenship age marital status veteran status disability status or any other characteristic protected by law Vercel encourages everyone to apply for our available positions even if they dont necessarily check every box on the job description LIDNI <p><p>
Chief Information Security Officer
Company: Grafana Labs
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> <strong> About the role <strong> <p> <p> We are looking for a Chief Information Security Officer to lead our Security team reporting to the CTO You will be responsible for developing and implementing security strategies across the Security Engineering Assurance and Security Operations teams as well as liaising with other teams delivering parts of our overall security posture The ideal candidate will have a proven track record of building andor implementing and improving the maturity of security programs in Cloudbased SaaS organizations and possess excellent leadership and communication skills You must have significant engineering acumen as this is a highly technologydriven role <p> <p> Grafana and the LGTM stack continue to be highly successful open source projects and onpremise products with over a million instances of our application running in the wild Grafana is also the main frontend for Grafana Cloud where users can visualize their telemetry data as well as use our opinionated solutions for easier troubleshooting of both their infrastructure and their applications <p> <p> <strong> Responsibilities <strong> <p> <ul> <li> <p> Define and optimize the security strategy in concert with your leadership team ICs and stakeholders across the business <p> <li> <li> <p> Work with customers and prospects to address security concerns Supporting GTM where significant deals require input from the CISO to close <p> <li> <li> <p> Regular 11s coaching and mentoring to ensure your team members are motivated happy and engaged Providing continuous feedback to ensure that they can add value while maintaining high standards <p> <li> <li> <p> Collaborating with our Engineering Leaders and other organization stakeholders to help define and influence wider product strategy roadmaps and designs <p> <li> <li> <p> Lead effective risk management and compliance programs <p> <li> <li> <p> Be actively engaged with significant incidents including preparation simulation response and affected customer notification and communications <p> <li> <li> <p> Maintain executive board and investor relations with regard to security <p> <li> <ul> <p> <strong> Requirements <strong> <p> <ul> <li> <p> You have previous experience as a CISO or CSO at a B2B cloudbased SaaS company IPO experience is a plus <p> <li> <li> <p> While the core focus of the role is on leadership strategy and executive communications you should have enough technical skillsunderstanding of our stack to manage and challenge a highly technical team and help them arrive at strong decisions <p> <li> <li> <p> You approach security with a DevOps mindset You prefer security by enablement automation and guardrails over gates and roadblocks <p> <li> <li> <p> You have familiarity with securing and operating on public Cloud AWS GCP Azure providers with Kubernetes and with securing combined opensource software OSS and SaaS products <p> <li> <li> <p> You will be comfortable working with engineering teams who have a strong sense of autonomy in their decisionmaking be it technical or productfocused <p> <li> <li> <p> You possess domain knowledge of common information security business continuity and privacy management frameworks regulatory requirements and applicable standards such as ISO 27001 SOC 2 HIPAA GDPR PCI FedRamp SOX etc You have experience maintaining these standards while maintaining operational efficiency <p> <li> <li> <p> You are an excellent written and verbal communicator You can articulate complex cybersecurity concepts to both technical and nontechnical audiences You are adept as translating security problems to business impact <p> <li> <ul> <p> <strong> Bonus Points <strong> <p> <ul> <li> <p> A technical background ideally as a software engineer before transitioning into security amp leadership <p> <li> <li> <p> Experience with highly regulated industries such as healthcare the US government and publicly listed companies <p> <li> <li> <p> Working knowledge of Grafana Labs OSS projects and products Experience in using observability tooling to solve security problems <p> <li> <li> <p> Experience working with OSS communities <p> <li> <li> <p> Experience securing large scale distributed systems <p> <li> <ul> <p> In the USA the Base compensation range for this role is $223600 $267000 Actual compensation may vary based on level experience and skillset as assessed in the interview process Benefits include equity bonus if applicable and other benefits listed <a class=fontbold underline fontbold underline fontbold underline href=httpsgrafanacomaboutcareersjobs rel=noopener noreferrer nofollow target=blank> here <a> <p> <p> <em> Compensation ranges are country specific If you are applying for this role from a different location than listed above your recruiter will discuss your specific markets defined pay range amp benefits at the beginning of the process <em> <p><p>
Distributed Systems Engineer, L5 - OC Tools Runtime
Company: Netflix
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> How do you spark joy in hundreds of millions of people It starts with a vision that technology can give voice to stories around the world In delivering those muchloved stories Netflix is responsible for a significant portion of global internet traffic <p> <p> <p> <p> To steward that responsibility we work collaboratively with ISPs to deploy <a class=fontbold underline fontbold underline postingslink href=httpsmedianetflixcomencompanybloghownetflixworkswithispsaroundtheglobetodeliveragreatviewingexperience rel=noopener noreferrer nofollow target=blank> Open Connect <a> Netflixs Content Delivery Network CDN which delivers 100 of Netflixs video traffic Our teams mission is to support that delivery by providing an automation and tooling platform that supports the internal operations and external partnerships needed to provide a fantastic viewing experience for all Netflix members We are looking for a talented software engineer specializing in infrastructure to join us on that mission <p> <p> <p> <p> <strong> The Role <strong> <p> <p> You will be charged with handling impactful availability scalability and usability challenges and must selfdefine optimal ways to configure manage and observe our growing Open Connect platform Our platform is a fundamental building block to our streaming initiatives providing critical solutions for one of the worlds largest CDNs and empowering stakeholders to operate the CDN more efficiently and reliably <p> <p> <p> <p> <p> <p> <p> <p> <strong> In this position you will have the opportunity to work in a wide variety of areas such as <strong> <p> <ul> <li> <p> Implementing microservices to enable analytics insights discovery and visualizations <p> <li> <li> <p> Designing orchestration to manage many thousands of globally distributed appliances and devices <p> <li> <li> <p> Building data models and APIs to help manage and maintain our fleet <p> <li> <li> <p> Understanding the breadth of our multitenant platform creating generalized solutions which can be leveraged across multiple domains including networking video and gaming <p> <li> <ul> <p> <p> <p> <strong> You Are <strong> <p> <ul> <li> <p> Someone who likes to work handson and selfdirect in a fastpaced environment that gives you great freedom and responsibility <p> <li> <li> <p> Able to see beyond immediate specifications can summarize requirements and architect forwardlooking solutions that cross multiple applications <p> <li> <li> <p> Capable of working in a highlycollaborative environment alongside your teammates engineers Partner Engagement Managers project managers and operations teams <p> <li> <li> <p> Articulate in communicating opportunities for continuous improvements to existing systems with a clear understanding of the impact on the business <p> <li> <li> <p> Always striving to develop and deploy in measured increments while taking responsibility for the quality of your work <p> <li> <ul> <p> <p> <p> <strong> Required Skills <strong> <p> <ul> <li> <p> 5+ years of expertise in Java or similar objectoriented language with confidence and experience in debugging and problemsolving skills <p> <li> <li> <p> Deep understanding of cloud architecture and application deployment <p> <li> <li> <p> Ability to build and support highly scalable robust and faulttolerant services <p> <li> <li> <p> Comprehensive knowledge of architecting and maintaining largescale distributed systems while handling high concurrency <p> <li> <li> <p> Experience designing implementing and debugging systems that interact with largesized data sets <p> <li> <li> <p> Excellent verbal and written communication skills <p> <li> <ul> <p> <p> <p> <strong> Bonus Skills <strong> <p> <ul> <li> <p> Knowledge of CDN architectures and networking fundamentals TCPIP BGP DNS <p> <li> <li> <p> Experience with multiple data stores and streaming services such as MySQL Postgres Elasticsearch Cassandra Kafka or Redis <p> <li> <li> <p> Familiarity with GraphQL or related graph modeling and querying concepts <p> <li> <li> <p> Handson Big Data experience using Hive Pig Hadoop or similar <p> <li> <li> <p> Understanding of frontend technologies including HTML CSS JavaScript WebSockets <p> <li> <ul> <p> <p> <p> <p> <p> Does this sound interesting Or does this sound interesting but intimidating Please dont selfselect out lets figure it out together Wed love to talk to you <p> <p> <p> <p> Our culture is unique and we tend to live by our values so its worth learning more about Netflix <a class=fontbold underline fontbold underline postingslink href=httpsjobsnetflixcomculture rel=noopener noreferrer nofollow target=blank> here <a> <p> <p> <p> <p> Our compensation structure consists solely of an annual salary we do not have bonuses You choose each year how much of your compensation you want in salary versus stock options To determine your personal top of market compensation we rely on market indicators and consider your specific job family background skills and experience to determine your compensation in the market range The range for this role is $100000 $720000 <p> <p> <p> <p> Netflix provides comprehensive benefits including Health Plans Mental Health support a 401k Retirement Plan with employer match Stock Option Program Disability Programs Health Savings and Flexible Spending Accounts Familyforming benefits and Life and Serious Injury Benefits We also offer paid leave of absence programs Fulltime hourly employees accrue 35 days annually for paid time off to be used for vacation holidays and sick paid time off Fulltime salaried employees are immediately entitled to flexible time off See more detail about our Benefits <a class=fontbold underline fontbold underline postingslink href=httpsjobsnetflixcomworklifephilosophy rel=noopener noreferrer nofollow target=blank> here <a> <p> <p> <p> <p> Netflix is a unique culture and environment Learn more <a class=fontbold underline fontbold underline postingslink href=httpsjobsnetflixcomculture rel=noopener noreferrer nofollow target=blank> here <a> <p> <p> <p> <p> We are an equalopportunity employer and celebrate diversity recognizing that diversity of thought and background builds stronger teams We approach diversity and inclusion seriously and thoughtfully We do not discriminate on the basis of race religion color ancestry national origin caste sex sexual orientation gender gender identity or expression age disability medical condition pregnancy genetic makeup marital status or military service <p><p>
Software Engineer - Seller Experience
Company: Whatnot
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <h2> <strong> 🚀 Whatnot <strong> <h2> <p> Whatnot is a livestream shopping platform and marketplace backed by Andreessen Horowitz Y Combinator and CapitalG Were building the future of ecommerce bringing together community shopping and entertainment We are committed to our <a class=fontbold underline fontbold underline fontbold underline href=httpswwwwhatnotcomcareers rel=noopener noreferrer nofollow target=blank> values <a> and as a remotefirst team we operate out of hubs within the US Canada UK Ireland and Germany today <p> <p> Were innovating in the fastpaced world of live auctions in categories including sports fashion video games and streetwear The platform couples rigorous seller vetting with a focus on community to create a welcoming space for buyers and sellers to share their passions with others <p> <p> And were growing Whatnot has been the <a class=fontbold underline fontbold underline fontbold underline href=httpsa16zcommarketplace100 rel=noopener noreferrer nofollow target=blank> fastest growing marketplace <a> in the US over the past two years and were hiring forwardthinking problem solvers across all functional areas <p> <h2> <strong> 💻 Role <strong> <h2> <p> The Seller Experience team plays a crucial role in empowering our community of sellers with tools and experiences that allow them to succeed and grow on Whatnot You will be at the forefront of developing scalable user friendly solutions that enhance the seller journey at every step of the lifecycle from onboarding scaling and growth The problems you will tackle span from Casual Resellers to Large Retailers <p> <h2> <strong> 👋 You <strong> <h2> <p> Curious about who thrives at Whatnot Weve found that low ego a growth mindset and leaning into action and high impact goes a long way here <p> <p> As our next Software Engineer you should have 5+ years of generalist software engineering experience at a fast growing technology company plus <p> <ul> <li> <p> We primarily use Python JavaScript Elixir and are open to others <p> <li> <li> <p> Excellent product instincts You first think about users rather than the best technical solution <p> <li> <li> <p> You are known for shipping products and features lightningfast <p> <li> <li> <p> Youre an excellent problem solver and dont need to be told exactly what to do <p> <li> <li> <p> Comfortable working across the stack backend and frontend <p> <li> <li> <p> Ability to pick up on new technologies very quickly <p> <li> <li> <p> Proven track record of delivering features <p> <li> <li> <p> Bonus Experience building technology in ecommerce contributing to seller experiences and success <p> <li> <ul> <h2> <strong> 💰Compensation <strong> <h2> <p> For USbased applicants <strong> <strong> $178000year to $235000year + benefits + stock options <p> <p> The salary range may be inclusive of several levels that would be applicable to the position Final salary will be based on a number of factors including level relevant prior experience skills and expertise This range is only inclusive of base salary not benefits more details below or equity in the form of stock options <p> <h2> <strong> 🎁 Benefits <strong> <h2> <ul> <li> <p> Flexible Time off Policy and Companywide Holidays including a spring and winter break <p> <li> <li> <p> Health Insurance options including Medical Dental Vision <p> <li> <li> <p> Work From Home Support <p> <ul> <li> <p> $1000 home office setup allowance <p> <li> <li> <p> $150 monthly allowance for cell phone and internet <p> <li> <ul> <li> <li> <p> Care benefits <p> <ul> <li> <p> $450 monthly allowance on food <p> <li> <li> <p> $500 monthly allowance for wellness <p> <li> <li> <p> $5000 annual allowance towards Childcare <p> <li> <li> <p> $20000 lifetime benefit for family planning such as adoption or fertility expenses <p> <li> <ul> <li> <li> <p> Retirement 401k offering for Traditional and Roth accounts in the US employer match up to 4 of base salary and Pension plans internationally <p> <li> <li> <p> Parental Leave <p> <ul> <li> <p> 16 weeks of paid parental leave + one month gradual return to work company leave allowances run concurrently with country leave requirements which take precedence <p> <li> <ul> <li> <ul> <h2> <strong> 💛 EOE <strong> <h2> <p> Whatnot is proud to be an Equal Opportunity Employer We value diversity and we do not discriminate on the basis of race religion color national origin gender sexual orientation age marital status veteran status parental status disability status or any other status protected by local law We believe that our work is better and our company culture is improved when we encourage support and respect the different skills and experiences represented within our workforce <p><p>
Software Engineer (Data Engineering)
Company: Equilibrium Energy
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <h3> <strong> What we are looking for <strong> <h3> <p> Equilibrium was founded with a vision for building a company where datacentric decisionmaking drives our operations Our reliance on closedloop MLinfused autonomous workflow decisionmaking puts data and data management at the foundation of everything we build and operate We are looking for talented and passionate software engineering professionals to design lay and support the technical foundation of our company data and thus drive our innovative collaborative and agile delivery culture <p> <h3> <strong> What you will do <strong> <h3> <ul> <li> <p> Support the design development implementation and maintenance of our data engineering <strong> <em> tools workflows processes and platforms <em> <strong> that underpin our data engineering efforts <p> <ul> <li> <p> Design and build infrastructure for optimal extraction transformation and loading of data from various data sources eg AWS tooling Databricks DBT Snowflake Temporal and SQL technologies <p> <li> <li> <p> Identify design and implement internal process improvements including redesigning infrastructure for greater scalability optimizing data delivery and automating manual processes <p> <li> <li> <p> Design and engineer performant highreliability systems to handle petabytes of data <p> <li> <ul> <li> <li> <p> Architecting mentoring implementing and supporting a data ingestion platform for cross company use and enablement <p> <ul> <li> <p> Building and designing the long term vision for data ingestion at the company to enables cross team collaboration and end to end data ownership <p> <li> <li> <p> Assemble large complex sets of data that meet nonfunctional and functional business requirements and build large scaled data pipelines <p> <li> <li> <p> Design and build analytical tools to accelerate and automate the implementation of new and changing data pipelines <p> <li> <ul> <li> <li> <p> Nurture improve and maintain our <strong> <em> data quality <em> <strong> including data accuracy availability performance and ease of access understanding of the data in our data engineering ecosystem <p> <ul> <li> <p> Ensure data pipelines provide the intended actionable insights into key business performance metrics including operational efficiency <p> <li> <li> <p> Design and implement scalable data validations per business and domain requirements <p> <li> <li> <p> Support a culture of continuous data quality improvement <p> <li> <ul> <li> <li> <p> Serve as a collaborative <strong> <em> subject matter expert <em> <strong> on our data and accelerate our understanding and use of our data <p> <ul> <li> <p> Work with stakeholders including executive product data and design teams to support their data engineering needs while assisting with data quality and comprehension <p> <li> <ul> <li> <ul> <h3> <strong> The minimum qualifications youll need <strong> <h3> <ul> <li> <p> Passion for clean energy and fighting climate change <p> <li> <li> <p> An advanced degree in computer science data science machine learning artificial intelligence operations research engineering or related quantitative discipline <p> <li> <li> <p> 8+ years of experience developing a globally distributed data services platform <p> <li> <li> <p> 8+ years coding experience Python Go Java or other applicable languages <p> <li> <li> <p> Expertise in data analysis and ETLELT <p> <li> <li> <p> Experience developing and operating largescale data pipelines demonstrating knowledge with technologies such as Airflow Luigi Spark Kafka ElasticSearch Cassandra RDBMS and SQL <p> <li> <li> <p> Advanced working SQL knowledge and experience working with relational databases query authoring SQL as well as working familiarity with a variety of databases <p> <li> <li> <p> Experience building and optimizing big data data pipelines architectures and data sets <p> <li> <li> <p> Experience performing root cause analysis on internal and external data and processes to answer specific business questions and identify opportunities for improvement <p> <li> <li> <p> Strong analytic skills related to working with unstructured datasets <p> <li> <li> <p> Build processes supporting data transformation data structures metadata dependency and workload management <p> <li> <li> <p> A successful history of manipulating processing and extracting value from large disconnected datasets <p> <li> <li> <p> A collaborationfirst mentality with a willingness to teach as well as learn from others <p> <li> <ul> <h3> <strong> Nice to have additional skills <strong> <h3> <ul> <li> <p> Familiarity with time series data transformation and ingestion <p> <li> <li> <p> Strong understanding of data science concepts <p> <li> <li> <p> Expertise in distributed database systems data lakes and data meshes <p> <li> <ul><p>
Enterprise Account Executive
Company: Praxis Labs
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> As a fast growing missiondriven startup we are looking to grow our Sales team by bringing on an Enterprise Account Executive to continue our momentum and success within Enterprise Accounts <p> <h3> <strong> Role amp Responsibilities <strong> <h3> <ul> <li> <p> Be the face of our product to new customers by helping to guide them in improving their workplace <p> <li> <li> <p> Youll build our relationships and community to a diverse set of industries customers and workforces <p> <li> <li> <p> Create and refine systems and processes to assist in optimizing processes for prospecting and solution development <p> <li> <li> <p> Manage and support the performance and development of your team members help them grow into experts in the field <p> <li> <li> <p> Partner with Marketing on thought leadership opportunities and in field activities eg blogs events conferences <p> <li> <li> <p> Establish strong partnerships with CS Product and crossfunctional teams to grow Praxis Labs <p> <li> <li> <p> Articulate and create Praxis Labs business value through engaging executive level presentations <p> <li> <ul> <h3> <strong> Ideal Qualifications <strong> <h3> <ul> <li> <p> 5+ years of experience selling and closing SaaS technology or other business applications to large enterprises <p> <li> <li> <p> Experience selling to Clevel executives and preferably having an understanding of the HR or LampD landscape and existing challenges and solutions <p> <li> <li> <p> Ability to define and execute the entire sales lifecycle and preferably familiar with Command of the Message or other value selling methodologies <p> <li> <li> <p> Ability to prioritize and discover new opportunities within customer and new logo accounts <p> <li> <li> <p> Cares deeply about diversity equity inclusion and justice and is a conscious and inclusive leader comfortable talking about DEIJ topics <p> <li> <li> <p> Lives Praxis Labs values of being vocal clear communicator being generous with time with feedback be praxis data driven be brave unafraid to try and fail and be openminded seeks out diverse perspectives and be curious asks questions seeks to learn <p> <li> <li> <p> Is comfortable and not easily overwhelmed in a fastpaced role and missiondriven environment <p> <li> <ul> <p> <em> The pay range for this position at the start of employment is expected to be between <em> <strong> <em> $220000 $270000 salary+commission <em> <strong> <em> However the base pay offered may vary depending on multiple factors including jobrelated knowledge skills experience market factors location and business need <em> <p><p>
Senior Software Engineer - AI
Company: Synack
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> At Synack we create technology that unleashes the best cybersecurity talent to secure our digital world <p> <p> We protect leading global organizations by reducing companies security risk and increasing their resistance to cyber attack How do we do this By utilizing the worlds best and most trusted team of ethical hackers who test through our powerful and controlled platform to deliver real security without compromise <p> <p> Backed by toptier venture capital firms including Kleiner Perkins Caufield amp Byers Microsoft and Google Ventures Synacks mission is to leverage global security talent coupled with advanced technology to help enterprises discover security vulnerabilities before they become business problems Discover the possibilities at Synack <p> <p> We are looking for a Senior Software Engineer AI where youll be spearheading the development of cuttingedge AIdriven solutions tailored for the offensive security sector This role demands a handson approach to designing developing and deploying machine learning models that address specific cybersecurity challenges enhancing our product offerings and meeting our customers critical needs Youll lead by example mentoring junior engineers and promoting a culture of technical excellence innovation and continuous improvement <p> <p> Sounds interesting Keep reading <p> <p> <strong> Please note <strong> This is a remote position based in the US We can only hire US citizens for this position due to federal government contract requirements <p> <p> <p> <p> <strong> Heres what youll do <strong> <p> <ul> <li> <p> Design implement and deliver scalable AI and machine learning solutions <p> <li> <li> <p> Develop robust AI models capable of identifying vulnerabilities automating penetration testing processes workflow optimization and enhancing threat intelligence <p> <li> <li> <p> Own and drive the endtoend development of AI product features from ideation to deployment monitoring and model management <p> <li> <li> <p> Actively participate in and contribute to design and implementation of AI solutions promoting best practices during the project lifecycle <p> <li> <li> <p> Lead technical discussions code reviews and design sessions sharing your expertise to uplift the teams capabilities <p> <li> <li> <p> Provide mentorship and support to junior engineers encouraging professional growth and development <p> <li> <li> <p> Collaborate closely with crossfunctional teams to integrate AI capabilities into broader systems and applications <p> <li> <ul> <p> <strong> Heres what youll need <strong> <p> <ul> <li> <p> 10+ years of experience in machine learning engineering with a strong foundation in statistics mathematics or a related field <p> <li> <li> <p> 3+ years of demonstrated experience in designing and implementing machine learning models and data pipelines in production environments <p> <li> <li> <p> Excellent problemsolving skills with the ability to translate complex business requirements into technical solutions <p> <li> <li> <p> Strong communication skills capable of presenting findings and insights to both technical and nontechnical audiences <p> <li> <li> <p> Proficient in Python and strong understanding of AI and machine learning algorithms and frameworks eg Tensorflow PyTorch <p> <li> <li> <p> Strong knowledge of data management systems both SQL eg PostgreSQL and NoSQL egMongoDB <p> <li> <li> <p> Demonstrated ability to work effectively in a teamoriented collaborative environment <p> <li> <ul> <p> <strong> Nice To Have <strong> <p> <ul> <li> <p> Expertise in AI and ML technologies especially Azure AI and Open AI demonstrating the ability to integrate into software solutions <p> <li> <li> <p> Interest or experience in Cyber Security <p> <li> <ul> <p> <strong> Ready to join us <strong> <p> <p> Synack is committed to embracing diversity Our people are our strength Each addition to our team is an opportunity to grow and diversify our ideas experiences and viewpoints We strive to be inclusive of Race Ethnicity Religion Sex LGBTQ+ Veterans Disabilities and Age Synack welcomes you <p> <p> As a candidate Synack cares about your privacy Please view our candidate privacy policy <a class=fontbold underline fontbold underline fontbold underline href=httpswwwsynackcomcandidateprivacynotice rel=noopener noreferrer nofollow target=blank> here <a> <p> <p> <strong> $145000 $235000 py <strong> Salary is determined by a combination of factors including location level relevant experience and skills The range displayed on each job posting reflects the minimum and maximum target for new hire salaries for the position across all US locations The compensation package for this position may also include equity and benefits For more details about our benefits please see <a class=fontbold underline fontbold underline fontbold underline href=httpssynackmybenefitslife rel=noopener noreferrer nofollow target=blank> here <a> Then for the Employer code enter <strong> synack <strong> <p><p>
Principal Software Engineer
Company: RapidAI
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> RapidAI is the global leader in using AI to combat lifethreatening vascular and neurovascular conditions RapidAI is empowering physicians to make faster decisions for better patient outcomes leading the next evolution of clinical decisionmaking and patient workflow Based on intelligence gained from over 10 million scans in more than 2000 hospitals in over 60 countries the Rapid® platform transforms care coordination offering care teams a level of patient visibility never before possible RapidAI where AI meets patient care <p> <p> <p> <p> <p> <p> <strong> What you will do <strong> <p> <ul> <li> <p> Design complex scalable software systems and architectures Evaluate existing architectures and propose improvements Ensure technical decisions align with product roadmap <p> <li> <li> <p> Plan technical projects and milestone deliverables in alignment with product managers Coordinate engineers and their tasks and monitor overall progress <p> <li> <li> <p> Design and build impactful technical solutions and own them through the entire development lifecycle <p> <li> <li> <p> Develop complex features and components Review code and designs developed by other engineers Debug difficult issues across the codebase <p> <li> <li> <p> Research the latest technologies and propose ways to integrate them to improve the product Come up with solutions for technical challenges and improvements <p> <li> <li> <p> Provide technical guidance and mentorship to other engineers Establish engineering best practices and standards <p> <li> <li> <p> Clearly communicate complex technical concepts and designs to both technical and nontechnical audiences Collaborate cross functionally across product program management and other teams <p> <li> <li> <p> Establish quality standards design review checklists code review processes etc Monitor system performance and ensure quality goals are met Drive continuous improvement <p> <li> <ul> <p> <p> <p> <strong> What you bring <strong> <p> <ul> <li> <p> Bachelors Degree or equivalent <p> <li> <li> <p> 12+ years of experience in software development and demonstrated engineering leadership <p> <li> <li> <p> 8+ years of experience in backend development <p> <li> <li> <p> 3+ years in using Typescript and Amazon AWS <p> <li> <li> <p> High level of skill in at least one generalpurpose backend language and one frontend language but willingness to work with other languages if required <p> <li> <li> <p> High level of distributed system design skill <p> <li> <li> <p> Creating platforms reusable libraries and utilities wherever applicable <p> <li> <li> <p> Writing highquality code that is modular functional and testable <p> <li> <li> <p> Troubleshoot issues effectively in a distributed architecture <p> <li> <li> <p> Communicate collaborate and work effectively in a global environment <p> <li> <li> <p> Solid analytical and reasoning skills for design troubleshooting and root cause analysis <p> <li> <li> <p> Great communication skills with technical and nontechnical teams <p> <li> <ul> <p> <p> <p> <strong> Bonus Skills <strong> <p> <ul> <li> <p> iOS or Android development experience Swift Kotlin and good understanding of Native mobile <p> <li> <li> <p> Experience in a regulated software environment eg medical device aerospace defense automotive <p> <li> <li> <p> Experience with DICOM HL7 or other medical data formatsprotocols <p> <li> <ul> <p> <p> <p> <strong> What we offer you <strong> <p> <ul> <li> <p> RapidAI pays 100 for employee coverage amp 75 for your dependent coverage for medical dental amp vision premiums <p> <li> <li> <p> Medical Benefits We offer a range of policies through TriNet <p> <li> <li> <p> Life InsuranceADampD is 1X times your annual salary <p> <li> <li> <p> We pay 100 for Short and Long Term Disability <p> <li> <li> <p> Healthcare and Dependent care flexible spending accounts are available <p> <li> <li> <p> A 401k plan is offered through Empower <p> <li> <li> <p> RapidAI provides $100 a month for internetcellphone services <p> <li> <ul> <p> Time Off <p> <ul> <li> <p> We have 10 company paid holidays <p> <li> <li> <p> RapidAI has a flexible vacation policy We urge employees to take vacation Vacation allows employees to renew reinvigorate and rejuvenate <p> <li> <ul> <p> Other Cool Benefits <p> <ul> <li> <p> Equity Stock Options <p> <li> <li> <p> Incentive Compensation <p> <li> <li> <p> And most importantly You are joining an awesome team <p> <li> <ul> <p> <p> <p> <p> <p> <strong> Compensation <strong> The salary range target for the role described in this job description is $200000 to $208000 Final offer amounts depend on multiple factors including but not limited to candidate experience and expertise geographic location compensationequity mix and market data This position may also be eligible for additional incentives such as equity awards shortterm incentives or sales compensation <p> <p> <p> <p> RapidAI is committed to creating an inclusive and diverse workplace We provide equal employment opportunities to all employees and applicants and prohibit discrimination and harassment of any type in regard to race color religion age sex national origin disability status genetics protected veteran status sexual orientation gender identity or expression or any other characteristic protected by federal state or local laws <p> <p> <p> <p> Please review our CPRA policies <a class=fontbold underline fontbold underline postingslink href=httpsrapidaiboxcomsbc5l0izmwcyf8mu34sbsalmzx4ly1mkl rel=noopener noreferrer nofollow target=blank> here <a> <p> <p> For more information on the information we collect about our applicants and how we use it see our CPRA Privacy Notice <a class=fontbold underline fontbold underline postingslink href=httpsrapidaiboxcomslpyfu84mmopywvcox0i4ej15c4v84ck1 rel=noopener noreferrer nofollow target=blank> here <a> <p><p>