Retirement Plan Jobs in USA

246,087 open positions · Updated daily

The Retirement Plan sector in USA is experiencing rapid growth as companies broaden retirement offerings to attract top talent.

In 2023, the number of Retirement Plan jobs in USA increased by 9%, reflecting a shift toward more comprehensive employee benefits.

Salary transparency on jobtransparency.com reveals that entry-level Retirement Plan roles in USA average $60,000, while senior positions can exceed $120,000.

Benefits packages in USA Retirement Plan roles often include 401(k) matching, profit sharing, and health insurance, making these positions highly competitive.

Director - Corporate FP&A

Company: Icertis

Location: USA

Posted Apr 30, 2024

With unmatched technology and categorydefining innovation Icertis pushes the boundaries of whats possible with contract lifecycle management CLM The AIpowered analystvalidated Icertis Contract Intelligence ICI platform turns contracts from static documents into strategic advantage by structuring and connecting the critical contract information that defines how an organization runs Today the worlds most iconic brands and disruptive innovators trust Icertis to fully realize the intent of their combined 10 million contracts worth more than $1 trillion in 40+ languages and 93 countries Who we are Icertis is the only contract intelligence platform companies trust to keep them out in front now and in the future Our unwavering commitment to contract intelligence is grounded in our FORTE valuesFairness Openness Respect Teamwork and Executionwhich guide all our interactions with employees customers partners and stakeholders Because in our mission to be the contract intelligence platform of the world we believe how we get there is as important as the destination As the Director of FPampA you will play a critical leadership role you will work closely with all of companys functional leaders and bring key market strategic and operational insights that will shape the direction of the company and accelerate its growth You will also play a key role in telling the companys financial story to investors The ideal candidate will have a proven trackrecord of driving business outcomes through keen financial insight and business modeling They will have the ability to create a 360degree financial picture of the business that reflects and influences the companys strategy and be excellent at communicating with senior leaders and executives They will be toolsavvy with experience in creating scalable data and reporting solutions that support a datadriven culture LIRS1 What you will do <ul> <li> Formulate a robust 360degree financial picture of the business complete with market insights and operational drivers <li> <li> Develop and maintain the 3year Strategic Planning Model and forecast <li> <li> Deliver Global PampL and cash flow forecasts <li> <li> Drive Annual Planning Process work cross functionally to build and maintain the Annual Financial Plan and Departmental Budgets <li> <li> Build and deliver Business Performance ReportingOperating dashboards <li> <li> Perform strategic business analysis as needed MampA Geo Expansion <li> <li> Prepare financial analyses as needed to help drive improvements in the business Current focus areas include market expansion opportunities competitive benchmarking analyses pricing and strategic financial optimization strategies <li> <li> Partner with Controller to enhance and accelerate the financial reporting process <li> <li> Identifies and implements system and process improvements to increase the efficiency and effectiveness of planning and reporting workflows <li> <li> Prepare communications to Board of Directors <li> <li> Drive investor presentations and supporting analysis <li> <li> Develop a deep understanding of the business metrics with an eye towards understanding the benefits and risks from a financial perspective and helping to manage key business drivers and desired outcomes <li> <li> Play a key role in preparation of critical public financial documents to support the IPO process including working with bankers and supporting the production of investor materials and SEC filings eg S1 <li> <ul> What you will bring <ul> <li> 12+ years of experience of working in direct strategic analysis support of all aspects of the business at all areas of the PampL <li> <li> MBACPA or equivalent experience preferred <li> <li> Demonstrated complex modeling experience this is a handson role and managers are expected to directly contribute and lead by example <li> <li> Highly analytical detailoriented with a commitment to creating a highquality product Naturally inquisitive and able to extract information from various sources to identify and understand the underlying issue Not afraid to question results <li> <li> Prior success working in a fastpaced entrepreneurial environment takes initiative and works independently <li> <li> Working knowledge of accounting principles required including revenue recognition amortization and accrual vs cash accounting Must have a general understanding of financial statements <li> <li> Must have exceptional written visual and spoken communication skills <li> <li> Experience in preparing and delivering executive board and investor level communications <li> <li> IPO experience is a plus <li> <li> Must have advanced Excel Netsuite and Powerpoint skills <li> <li> Experience implementing financial analysis and planning tools required <li> <ul> $146000 $219000 a year Pay offered will vary based on jobrelated factors such as location experience training skills and abilities In addition to the base salary and annual bonus target and an equity component is included in the compensation package What we offer We are committed to the health and wellbeing of all Icertians their families the communities they live in and our customers This commitment is represented in the Icertis Four Rings of Responsibility Take Care of Self Take Care of Family Take Care of Community and Take Care of Business in that order To support these commitments Icertis offers excellent health and welfare benefits a generous 401k match and a robust paid time off program Here are some of the other reasons <a class=fontbold underline fontbold underline postingslink href=httpswwwicertiscomcompanynewsicertisplacesfirstinwashingtons100bestcompaniestoworkfor rel=noopener noreferrer nofollow target=blank> Icertis Places First in Washingtons 100 Best Companies to Work For | Icertis <a> ● Equity RSUs and shared ownership in the company ● Flexible work environment ● Paid maternity and paternity leave ● 7 Days for Humanity 7 paid volunteer days ● Generous holidays including the 4th of July week off paid ● Free professional and leadership coaching ● Annual personal development allowance Icertis Inc provides Equal Employment Opportunity to all employees and applicants for employment without regard to race color religion gender identity or expression sex sexual orientation national origin age disability genetic information marital status amnesty or status as a covered veteran in accordance with applicable federal state and local laws Icertis Inc complies with applicable state and local laws governing nondiscrimination in employment in every location in which the company has facilities If you are in need of accommodation or special assistance to navigate our website or to complete your application please send an email with your request to <a class=fontbold underline fontbold underline postingslink href=mailtocareersicertiscom rel=noopener noreferrer nofollow target=blank> careersicertiscom <a> or get in touch with your recruiter By submitting your application you acknowledge that you have read Icertiss Privacy Policy <a class=fontbold underline fontbold underline postingslink href=httpswwwicertiscomprivacystatement rel=noopener noreferrer nofollow target=blank> httpswwwicertiscomprivacystatement <a> Icertis is not open to third party solicitation or resumes for our posted FTE positions Resumes received from third party agencies that are unsolicited will be considered complimentary

View Details Apply on workingnomads

Brand Designer

Company: Modern Health

Location: USA

Posted Apr 30, 2024

<h2> The Role <h2> Are you an ambitious creative professional Does joining a rapidlygrowing tech company in the health and mental wellbeing space sound exciting The Marketing team at Modern Health is hiring a Brand Designer to help build our brand identity as we expand executing a wide range of projects including web content email newsletters videos advertising conference materials sales presentations onesheeters and much more You will be a key member of the Marketing team collaborating across product customer success clinical care and recruiting to build a cohesive elevated brand for Modern Health and to ensure specific messages are being visually conveyed through your designs This position is not eligible to be performed in Hawaii <h2> What Youll Do <h2> <ul> <li> Manage project request intake and scope clarification <li> <li> Design and development of marketing materials including website pages presentations print and digital advertising conference materials research reports social media campaigns onesheeters postcards promotions videos webinars and other marketing collateral <li> <li> Collaborate with other marketing and product team members to ensure quality and consistency in all aspects of our brand presence <li> <li> Provide status updates and juggle multiple projectswere an agile team with shifting priorities <li> <li> Become an informed and vocal advocate of great design at Modern Health <li> <ul> <h2> Who You Are <h2> <ul> <li> 3+ years of design experience in a fastpaced highgrowth environment <li> <li> MUST have an online portfolio of relevant work examples <li> <li> Handson experience with Figma Adobe Creative Suite including Photoshop and llustrator <li> <li> Use of MS Office and Google Docs and how those are used crossfunctionally with Adobe CS <li> <li> Experience working with web developer to develop website pages <li> <li> Knowledge of how to prepare files for optimal online use and print bleed areas CMYK Pantone RGB etc <li> <li> Understand the different pixel resolutions required for print and online <li> <li> Experience working within existing brand guidelines andor designing new brand guidelines <li> <li> Must be highly detail oriented and selfmotivated and able to prioritize your workload to meet critical deadlines <li> <li> Able to work well independently as well as under the direction of others <li> <li> Coachable and values constructive criticism from a variety of sources <li> <li> Excellent written and verbal communication skills <li> <li> Curious creative flexible proactive and ambitious <li> <ul> <h2> Benefits <h2> Fundamentals <ul> <li> Medical Dental Vision Disability Life Insurance <li> <li> High Deductible Health Plan with Health Savings Account HSA option <li> <li> Flexible Spending Account FSA <li> <li> Access to coaches and therapists through Modern Healths platform <li> <li> Generous Time Off <li> <li> Companywide Collective Pause Days <li> <ul> Family Support <ul> <li> Parental Leave Policy <li> <li> Family Forming Benefit through Carrot <li> <li> Family Assistance Benefit through UrbanSitter <li> <ul> Professional Development <ul> <li> Professional Development Stipend <li> <ul> Financial Wellness <ul> <li> 401k <li> <li> Financial Planning Benefit through Origin <li> <ul> But wait theres more <ul> <li> Annual Wellness Stipend to use on items that promote your overall well being <li> <li> New Hire Stipend to help cover workfromhome setup costs <li> <li> ModSquad Community Virtual events like active ERGs holiday themed activities teambuilding events and more <li> <li> Monthly Cell Phone Reimbursement <li> <ul>

View Details Apply on workingnomads

Machine Learning Engineer (L3)

Company: Twilio

Location: USA

Posted Apr 30, 2024

<h3> See yourself at Twilio <h3> Join the team as Twilios next Machine Learning Engineer L3 on the Data Services and Throughput team <h3> Who we are amp why were hiring <h3> Twilio powers realtime business communications and data solutions that help <a class=fontbold underline fontbold underline fontbold underline href=httpscustomerstwiliocom rel=noopener noreferrer nofollow target=blank> companies and developers worldwide <a> build better applications and customer experiences Although were headquartered in San Francisco we have presence throughout South America Europe Asia and Australia Were on a journey to becoming a global company that actively opposes racism and all forms of oppression and bias At Twilio we support <a class=fontbold underline fontbold underline fontbold underline href=httpswwwtwiliocomcompanydiversity rel=noopener noreferrer nofollow target=blank> diversity equity amp inclusion <a> wherever we do business <h3> About the job <h3> This position is needed to to drive the innovation and creation of cuttingedge products that serve the needs of developers builders and operators You will be a crucial bridge between Product and Design tasked with developing evaluating and maintaining scalable Machine Learning models within lowlatency for realtime applications Your collaboration and expertise will be fundamental in delivering robust solutions that power our users success You will be closely working with a crossfunctional team of engineers architects product UIUX and partners to develop ML and data driven algorithm aspects of customer facing products in Twilio Communication applications Twilio Communications is the leading software for sending messages programmatically The Data Services and Throughput organization builds AIenabled capabilities that separate Twilio from its competitors in messaging capabilities <h3> Responsibilities <h3> In this role youll <ul> <li> Build and maintain scalable high quality machine learning solutions in production <li> <li> Design and implement tools and procedures to evaluate performance and accuracy of models and data <li> <li> Work closely with software engineers build tools to enhance productivity and to ship and maintain ML models <li> <li> Demonstrate endtoend understanding of applications and why behind models amp systems and develop high quality MLbased software at scale <li> <li> Truly own the product you work on Be responsible for SLA on call incident resolution customer feedback and participate in blameless postmortems to make our products better <li> <li> Partner with product managers tech leads and stakeholders to analyze business problems clarify requirements and define the scope of the systems and leverage stateoftheart Statistics Machine Learning Deep Learning and Gen AI to address the business problems <li> <li> Drive high engineering standards on the team through code review automated testing and mentoring <li> <li> Collaborate and brainstorm product ideas with product managers designers and engineers <li> <ul> <h3> Qualifications <h3> Not all applicants will have skills that match a job description exactly Twilio values diverse experiences in other industries and we encourage everyone who meets the required qualifications to apply While having desired qualifications make for a strong candidate we encourage applicants with alternative experiences to also apply If your career is just starting or hasnt followed a traditional path dont let that stop you from considering Twilio We are always looking for people who will bring something new to the table Required <ul> <li> 4+ years of applied ML experience <li> <li> Strong background in the foundations of machine learning and building blocks of modern deep learning <li> <li> Proficiency in Python or Java and familiarity with design patterns <li> <li> Track record of building shipping and maintaining machine learning models in production <li> <li> Extensive experience in technologies such as PyTorch Tensorflow Scikitlearn Spacy NLTK application frameworks eg Flask <li> <li> Deep understanding of ML model implementation cycle eg feature engineering trainingserving AB test model selection etc algorithms eg xgboost time series models deep learning graph neural networks optimization and domains eg forecasting personalization and recommendation system NLP embedding representation <li> <li> Familiarity with MLOps concepts related and maintaining models in production such as testing versioning model registry retraining and monitoring <li> <li> Demonstrated ability to ramp up understand and operate effectively in new application business domains <li> <li> Good written and verbal communication skills You are confident in writing down and presenting your designs and decisions throughout the development lifecycle You are also comfortable providing and receiving feedback in an Agile environment <li> <ul> Desired <ul> <li> Experience in recommendation systems forecasting models NLP techniques embedding representation approaches and statistical models <li> <li> Experience with Retrieval Augmented Generation Large Language Models and prompt engineering <li> <li> Knowledge of Java and system design concepts <li> <li> Understanding of Experience with CICD pipelines and automated deployment processes <li> <li> Experience with either AWS Azure or Google Cloud and technologies such as Spark Kafka Kubeflow GPU <li> <ul> <h3> Location <h3> This role will be and based in the US but is not eligible to be hired in NY WA CT CA and PA <h3> Travel <h3> We prioritize connection and opportunities to build relationships with our customers and each other For this role you may be required to travel occasionally to participate in project or team inperson meetings <h3> What We Offer <h3> There are many benefits to working at Twilio including in addition to competitive pay things like generous timeoff ample parental and wellness leave healthcare a retirement savings program and much more Offerings vary by location <h3> Twilio thinks big Do you <h3> We like to solve problems take initiative pitch in when needed and are always up for trying new things Thats why we seek out colleagues who embody our values something we call <a class=fontbold underline fontbold underline fontbold underline href=httpswwwtwiliocomcompanyvalues rel=noopener noreferrer nofollow target=blank> Twilio Magic <a> Additionally we empower employees to build <a class=fontbold underline fontbold underline fontbold underline href=httpstwilioorgsupportandresourcesimpactfund rel=noopener noreferrer nofollow target=blank> positive change in their communities <a> by supporting their volunteering and donation efforts So if youre ready to unleash your full potential do your best work and be the best version of yourself apply now If this role isnt what youre looking for <a class=fontbold underline fontbold underline fontbold underline href=httpswwwtwiliocomcompanyjobsopenpositions rel=noopener noreferrer nofollow target=blank> please consider other open positions <a> Please note this role is open to candidates outside of Colorado California New York and Washington The information below is provided for candidates hired in those locations only The estimated pay ranges for this role are as follows <ul> <li> Based in Colorado $13500 $169000 <li> <li> This role may be eligible to participate in Twilios equity plan and corporate bonus plan All roles are eligible for the following benefits health care insurance 401k retirement account paid sick time paid personal time off paid parental leave <li> <ul> The successful candidates starting salary will be determined based on permissible nondiscriminatory factors such as skills experience and geographic location within the state Twilio is proud to be an equal opportunity employer Twilio is proud to be an Equal Employment Opportunity and Affirmative Action employer We do not discriminate based upon race religion color national origin sex including pregnancy childbirth reproductive health decisions or related medical conditions sexual orientation gender identity gender expression age status as a protected veteran status as an individual with a disability genetic information political views or activity or other applicable legally protected characteristics We also consider qualified applicants with criminal histories consistent with applicable federal state and local law Additionally Twilio participates in the EVerify program in certain locations as required by law Twilio is committed to providing reasonable accommodations for qualified individuals with disabilities and disabled veterans in our job application procedures If you need assistance or an accommodation due to a disability please contact us at accommodationtwiliocom

View Details Apply on workingnomads

Deputy Director, - Campaigns

Company: CALSTART

Location: USA

Posted Apr 29, 2024

About Us For over 30 years its been CALSTARTs mission to develop assess and implement largescale zeroemission transportation solutions to mitigate climate change and support economic growth CALSTART works with businesses organizations governments and communities to create reallife impact toward clean air and equitable access to clean transportation for all CALSTART provides scientific technical and policy support for regulatory development and clean technology and infrastructure acceleration About The Role Are you a creative thinker with a passion for communication and great prose Are you excited about decarbonizing the transportation industry globally through crafting educational content social media strategies virtual events with countries all over the world CALSTARTs Drive to Zero team is looking for a dynamic marketing manager passionate about zero emissions to develop and execute marketing campaigns In this role you will be responsible for overall campaign strategy execution evaluation and optimization globally You will be responsible for driving digital and content strategy through media paid resources email webinars and events The ideal candidate will have experience of managing multiple highprofile projects simultaneously in partnership with crossfunctional teams developing messaging storytelling while streamlining processes They will possess a successful track record of executing multichannel campaigns that expand awareness acquire and convert new signatories and drive demand Content strategy will be your passion What Youll Do <ul> <li> Create and execute the marketing strategy for CALSTARTs global Drive To Zero program which includes but not limited to social email paid media events webinars <li> <li> Responsible for the successful execution of 4 virtual events per year <li> <li> Build graphics flyers short videos to help promote new country signatories to join the global MOU <li> <li> Support adhoc marketing requests as needed <li> <li> Support marketing campaigns for Truck and OffRoad initiative <li> <ul> What Youll Bring To The Table <ul> <li> 6+ years of professional marketing experience <li> <li> 6+ years of program related work <li> <li> Experience with data analytics <li> <li> Experience creating executing and scaling marketing campaigns from concept to completion across multiple media platforms and strategies <li> <li> Loves teamwork and rolling up their sleeves to get the job done <li> <li> Excellent interpersonal and communication skills <li> <li> Bachelor degree <li> <ul> Desired Qualifications <ul> <li> Masters degree <li> <li> Experience developing and executing campaigns across a many time zones and languages <li> <li> Experience with customer segmentation profiling and targeting <li> <li> Mailchimp andor Salesforce experience an added bonus <li> <li> The ability to make things happen quickly <li> <ul> $105630 $120260 a year CALSTART values transparency and strives to provide as much information regarding compensation as possible The complete salary range for this role is $105630 $120260 Pay for this role will typically be from $105630 $112945 as we determine pay based on several factors including but not limited to jobrelated skills qualifications experience education internal equity and other factors relevant to the job We understand that not everyone will match the above qualifications 100 If your background isnt perfectly aligned but you feel you would be a great addition to the team wed love to hear from you Were a tightknit team of worldclass innovators business minds and change agents who believe passionately in our mission and put our team ahead of self We are committed to the continued development and growth of our employees and invest in your success We care about your personal well being as much as your professional success and offer generous benefits to full time employees including 100 company paid comprehensive health benefits for Medical Dental Vision Short Term Disability Long Term Disability and Life Insurance Retirement plan with generous company contributions FSA for Health and Dependent Care 3 weeks of vacation time in the first year of employment 11 paid company holidays paid sick time paid family leave and more Our inclusive environment focuses on making decisions based on merit without regard to race color hair texture gender religion age nationality social or ethnic origin sexual orientation gender identity gender expression LGBTQIA+ status marital status pregnancy disability genetics veteran status or any other characteristic protected by law

View Details Apply on workingnomads

Enterprise Growth Account Executive consultative sales approach driving sales growth

Enterprise Account Manager

Company: Pagerduty

Location: USA

Posted Apr 29, 2024

PagerDuty is seeking an Enterprise Growth Account Executive with experience selling SaaS products to Enterprise accounts. The role involves leading and managing a pipeline of opportunities within existing accounts to deliver results against sales targets. The ideal candidate should have a consultative sales approach, a proven knack for driving sales growth, and the ability to captivate a tech-savvy audience. Key responsibilities include value selling, sales effectiveness, and sales execution. The base salary range for this position is 130,000 - 140,000 USD. PagerDuty offers a comprehensive total rewards approach, including competitive salary, comprehensive benefits, flexible work arrangements, and more.

View Details Apply on Remoteio

Software Engineer - Seller Experience

Company: Whatnot

Location: USA

Posted Apr 30, 2024

<h2> 🚀 Whatnot <h2> Whatnot is a livestream shopping platform and marketplace backed by Andreessen Horowitz Y Combinator and CapitalG Were building the future of ecommerce bringing together community shopping and entertainment We are committed to our <a class=fontbold underline fontbold underline fontbold underline href=httpswwwwhatnotcomcareers rel=noopener noreferrer nofollow target=blank> values <a> and as a remotefirst team we operate out of hubs within the US Canada UK Ireland and Germany today Were innovating in the fastpaced world of live auctions in categories including sports fashion video games and streetwear The platform couples rigorous seller vetting with a focus on community to create a welcoming space for buyers and sellers to share their passions with others And were growing Whatnot has been the <a class=fontbold underline fontbold underline fontbold underline href=httpsa16zcommarketplace100 rel=noopener noreferrer nofollow target=blank> fastest growing marketplace <a> in the US over the past two years and were hiring forwardthinking problem solvers across all functional areas <h2> 💻 Role <h2> The Seller Experience team plays a crucial role in empowering our community of sellers with tools and experiences that allow them to succeed and grow on Whatnot You will be at the forefront of developing scalable user friendly solutions that enhance the seller journey at every step of the lifecycle from onboarding scaling and growth The problems you will tackle span from Casual Resellers to Large Retailers <h2> 👋 You <h2> Curious about who thrives at Whatnot Weve found that low ego a growth mindset and leaning into action and high impact goes a long way here As our next Software Engineer you should have 5+ years of generalist software engineering experience at a fast growing technology company plus <ul> <li> We primarily use Python JavaScript Elixir and are open to others <li> <li> Excellent product instincts You first think about users rather than the best technical solution <li> <li> You are known for shipping products and features lightningfast <li> <li> Youre an excellent problem solver and dont need to be told exactly what to do <li> <li> Comfortable working across the stack backend and frontend <li> <li> Ability to pick up on new technologies very quickly <li> <li> Proven track record of delivering features <li> <li> Bonus Experience building technology in ecommerce contributing to seller experiences and success <li> <ul> <h2> 💰Compensation <h2> For USbased applicants $178000year to $235000year + benefits + stock options The salary range may be inclusive of several levels that would be applicable to the position Final salary will be based on a number of factors including level relevant prior experience skills and expertise This range is only inclusive of base salary not benefits more details below or equity in the form of stock options <h2> 🎁 Benefits <h2> <ul> <li> Flexible Time off Policy and Companywide Holidays including a spring and winter break <li> <li> Health Insurance options including Medical Dental Vision <li> <li> Work From Home Support <ul> <li> $1000 home office setup allowance <li> <li> $150 monthly allowance for cell phone and internet <li> <ul> <li> <li> Care benefits <ul> <li> $450 monthly allowance on food <li> <li> $500 monthly allowance for wellness <li> <li> $5000 annual allowance towards Childcare <li> <li> $20000 lifetime benefit for family planning such as adoption or fertility expenses <li> <ul> <li> <li> Retirement 401k offering for Traditional and Roth accounts in the US employer match up to 4 of base salary and Pension plans internationally <li> <li> Parental Leave <ul> <li> 16 weeks of paid parental leave + one month gradual return to work company leave allowances run concurrently with country leave requirements which take precedence <li> <ul> <li> <ul> <h2> 💛 EOE <h2> Whatnot is proud to be an Equal Opportunity Employer We value diversity and we do not discriminate on the basis of race religion color national origin gender sexual orientation age marital status veteran status parental status disability status or any other status protected by local law We believe that our work is better and our company culture is improved when we encourage support and respect the different skills and experiences represented within our workforce

View Details Apply on workingnomads

Product Design Manager, Tax Credits

Company: Gusto, Inc.

Location: USA

Posted Apr 30, 2024

Product Design at Gusto is made up of over 60 creative collaborative people who care deeply about our mission to empower small businesses and their employees Were a crossfunctional bunch focused on Design Research Writing Ops and Frontend Development who are always looking for opportunities to build understanding and empathy for the people who use Gusto We dont care a whole lot about swim lanes and we work closely with our partners in Product Engineering Data and Marketing to design build and ship experiences that make a difference We are passionate advocates for thoughtful crafted and inclusive experiences and we believe great design can make hard things possible even delightful <a class=fontbold underline fontbold underline fontbold underline href=httpsgustodesignnotionsiteDesignthefutureofworkatGusto1208931e36ae4da399ea4fa43f11b1e1 rel=noopener noreferrer nofollow target=blank> Read more about Design at Gusto <a> About the team At Gusto were dedicated to simplifying the complex world of business operations As a powerful People Platform we offer a comprehensive suite of essential products including payroll benefits time tracking and more all designed to streamline processes and empower businesses to thrive Our commitment to worldclass customer experience sets us apart Our Tax Credits team at Gusto is bringing to life an emerging market product for our customers We aim to help guide them through intricate tax credit regulations unlock financial opportunities and extend the runway for their businesses The Tax Credits team has ambitious goals to drastically simplify and demystify the complex world of tax credits in order to drive significant customer value and revenue for our business About the opportunity As the Product Design Manager for the Tax Credits team youll lead a small team of product designers to craft high quality and intuitive endtoend experiences for our customers Youll leverage your strategic business acumen to partner with senior crossfunctional leaders to plan and drive the roadmap and multiyear vision The work on Tax Credits is high visibility high impact experiences that balance complex technical and compliance requirements Your leadership will play a pivotal role in simplifying the intricate journey of discovering and securing tax credits ensuring its approachable userfriendly and stressfree Heres what youll do daytoday <ul> <li> Develop a deep understanding of the different customers we serve and how their varying needs translate into product requirements <li> <li> Work with crossfunctional partners in Product Management Engineering and Data Science to understand customer problems and identify key opportunities for the customer and our business Youll be the design representative on the senior quartet <li> <li> Empower a small team of product designers creating the conditions for them to do work theyre proud of and that serves the needs of our customers <li> <li> Craft the endtoend journeys and develop frameworks and principles that can be used to help align our teams on the right experiences <li> <li> Collaborate with our Research Data Science and Customer Support teams to build a holistic understanding of customer needs and make sure theyre shared with your teams to inform their thinking build empathy and inform prioritization decisions <li> <li> Collaborate with other key teams and stakeholders at Gusto such as Legal Compliance Risk Operations and other various product owners <li> <li> Ensure that proposed solutions are customerinformed through research data and insights from our Customer Support team <li> <li> Balance an iterative approach and urgency to solve customer pain with ensuring that short term improvements ladder up to longterm vision and meet a high bar for the customer experience <li> <li> Hold high standards for the customer experience including partnering with engineering partners to refine the end customer experience and ensure that what we release is bug free performant accessible and responsive <li> <li> Drive solutions that establish Gusto as a trusted tax expert advisor empowering our customers to make confident and informed tax credit decisions <li> <li> Identify emerging technologies and industry trends build business cases and define product vision and strategy <li> <li> Youll drive teamwide impact through leadership coaching and fostering a culture of growth and collaboration <li> <ul> Heres what were looking for <ul> <li> 8+ years Product Design experience with at least 2 of those years being in management roles <li> <li> Ideally youve worked on enabling simple easy to use experiences in complex domains like payroll benefits finance or banking etc Bonus if you have direct experience working on tax andor accounting products <li> <li> A track record of upleveling direct reports and raising the bar for design quality within an organization <li> <li> A proven track record of designing great UX for complex workflows and crafting endtoend experience visions and frameworks while showcasing an iterative approach toward execution <li> <li> A customerfocused mindset and can speak to the impact of the experience theyve shipped in tangible terms the business understands <li> <li> Strong opinions loosely held and a willingness to engage in constructive debates about scope and tradeoffs to build alignment and unblock workYouve built great relationships with cross functional collaborators and know how to model this for your team <li> <li> A proven track record of designing great UX for complex workflows and crafting endtoend experience visions and frameworks while showcasing an iterative approach toward execution <li> <li> A customerfocused mindset and can speak to the impact of the experience theyve shipped in tangible terms the business understands <li> <li> Strong opinions loosely held and a willingness to engage in constructive debates about scope and tradeoffs to build alignment and unblock workYouve built great relationships with cross functional collaborators and know how to model this for your team <li> <li> Communication and collaboration skills that enable you to explain the impact of your work tradeoffs youve made lessons learned and design rationale and generate alignment and enthusiasm across the company <li> <li> Ability to embrace ambiguous situations as opportunities to add clarity <li> <li> A builder who loves being hands on crafting high quality high impact solutions directly and through pairing with more junior team members <li> <ul> At Gusto we strive to provide rewards that empower employees to achieve their financial and personal goals We offer competitive compensation packages with a strong emphasis on equity based compensation ownership in Gusto To learn more about Gustos compensation philosophy and benefits offerings please view our <a class=fontbold underline fontbold underline fontbold underline href=httpsgustocomaboutcareerstotalrewards rel=noopener noreferrer nofollow target=blank> Total Rewards Approach page <a> Our cash compensation range for this role is $152000yr to $232000yr in Denver amp most remote locations and $185000yr to $251000yr in San Francisco amp New York Final offer amounts are determined by multiple factors including candidate experience and expertise and may vary from the amounts listed above

View Details Apply on workingnomads

Senior Backend Engineer - Styles

Company: Webflow

Location: USA

Posted Apr 30, 2024

At Webflow our mission is to bring development superpowers to everyone Webflow is the leading visual development platform for building powerful websites without writing code By combining modern web development technologies into one platform Webflow enables people to build websites visually saving engineering time while clean code seamlessly generates in the background From independent designers and creative agencies to Fortune 500 companies millions worldwide use Webflow to be more nimble creative and collaborative Its the web made better The Styles team is responsible for building and investing in the design capabilities of our core product to empower millions of designers worldwide to easily adopt Webflow to build manage and scale any number of sites efficiently Were looking for a Senior Backend Engineer to join the Styles team and lead the team to deliver impactful features for our customers to build highly personalized web experiences In this role you will execute the technical direction and be a mentor amp partner to other engineers on the team Additionally you will help lead crossfunctional efforts to drive even greater impact <h2> About the role <h2> <ul> <li> Location Remotefirst United States BC amp ON Canada <li> <li> Fulltime <li> <li> Permanent <li> <li> Exempt US Candidates <li> <li> Reporting to the Engineering Manager of Designer UX team <li> <li> The cash compensation for this role is tailored to align with the cost of labor in different geographic markets Weve structured the base pay ranges for this role into zones for our geographic markets and the specific base pay within the range will be determined by the candidates geographic location jobrelated experience knowledge qualifications and skills <ul> <li> Zone A $162500 $216050 <li> <li> Zone B $152700 $203100 <li> <li> Zone C $143000 $190150 <li> <ul> <ul> <li> CAD 184600 CAD 245500 <li> <ul> <ul> <li> United States all figures cited below in USD and pertain to workers in the United States <li> <li> Canada All figures cited below in CAD and pertain to workers in ON amp BC Canada <li> <ul> <li> <ul> Please visit our <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowaboutwebflowiocareers rel=noopener noreferrer nofollow target=blank> Careers page <a> for more information on which locations are included in each of our geographic pay zones However please confirm the zone for your specific location with your recruiter As a Senior Backend Engineer youll <ul> <li> Design and implement scalable backend services <li> <li> Drive crosspillar collaboration with software engineers product managers designers and QA analysts in an autonomous supportive team environment <li> <li> Effectively communicate team priorities and strategy to engineering and crossfunctional leadership teams <li> <li> Build and maintain unit and integration tests <li> <li> Provide clarity on processes and priorities to crosspillar partners and other engineers on the team <li> <li> Mentor other engineers on best practices code design considerations and quality <li> <ul> In addition to the responsibilities outlined above at Webflow we will support you in identifying where your interests and development opportunities lie and well help you incorporate them into your role <h2> About you <h2> Youll thrive as a Senior Backend Engineer Styles if you <ul> <li> Have 5+ years of experience in scalable multitenant environments <li> <li> Have 2+ years experience working with feature teams on customerfacing products shipping and iterating to solve customer problems <li> <li> Value testing and documentation equally as much as your code <li> <li> Are comfortable with ambiguity and scoping solutions with your teammates <li> <li> Are comfortable working on JavascriptTypescript MongoDB and Node <li> <li> Have consistently communicated trade offs throughout a project to meet both technical and business requirements <li> <li> Enjoy highvisibility work and presenting to executive counterparts <li> <li> Get excited about encouraging and developing other engineers <li> <ul> Even if you dont meet 100 of the above qualifications you should still seriously consider applying Research shows that you may still be considered for a role if you meet just half of the requirements Our Core Behaviors <ul> <li> Obsess over customer experience We deeply understand what were building and who were building for and serving We define the leading edge of whats possible in our industry and deliver the future for our customers <li> <li> Move with heartfelt urgency We have a healthy relationship with impatience channeling it thoughtfully to show up better and faster for our customers and for each other Time is the most limited thing we have and we make the most of every moment <li> <li> Say the hard thing with care Our best work often comes from intelligent debate critique and even difficult conversations We speak our minds and dont sugarcoat things and we do so with respect maturity and care <li> <li> Make your mark We seek out new and unique ways to create meaningful impact and we champion the same from our colleagues We work as a team to get the job done and we go out of our way to celebrate and reward those going above and beyond for our customers and our teammates <li> <ul> <h3> Benefits amp wellness <h3> <ul> <li> Equity ownership RSUs in a growing privatelyowned company <li> <li> 100 employerpaid healthcare vision and dental insurance coverage for employees and dependents fulltime employees working 30+ hours per week as well as Health Savings AccountHealth Reimbursement Account dependent care Flexible Spending Account US only dependent on insurance plan selection where applicable in the respective country of employment Employees may also have voluntary insurance options such as life disability hospital protection accident and critical illness where applicable in the respective country of employment <li> <li> 12 weeks of paid parental leave for both birthing and nonbirthing caregivers as well as an additional 68 weeks of pregnancy disability for birthing parents to be used before child bonding leave where local requirements are more generous employees receive the greater benefit Employees also have access to family planning care and reimbursement <li> <li> Flexible PTO with a mandatory annual minimum of 10 days paid time off for all locations where local requirements are more generous employees receive the greater benefit and sabbatical program <li> <li> Access to mental wellness and professional coaching therapy and Employee Assistance Program <li> <li> Monthly stipends to support health and wellness smart work and professional growth <li> <li> Professional career coaching internal learning amp development programs <li> <li> 401k plan and pension schemes in countries where statutorily required financial wellness benefits like CPA or financial advisor coverage <li> <li> Discounted Pet Insurance offering US only <li> <li> Commuter benefits for inoffice employees <li> <ul> Temporary employees are not eligible for paid holiday time off accrued paid time off paid leaves of absence or companysponsored perks unless otherwise required by law <h3> Be you with us <h3> At Webflow equality is a core tenet of our culture We are an Equal Opportunity EEOVeteransDisabled Employer and are <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomdiversityequityinclusion rel=noopener noreferrer nofollow target=blank> committed <a> to building an inclusive global team that represents a variety of backgrounds perspectives beliefs and experiences Employment decisions are made on the basis of jobrelated criteria without regard to race color religion sex sexual orientation gender identity national origin disability veteran status or any other classification protected by applicable law Pursuant to the San Francisco Fair Chance Ordinance Webflow will consider for employment qualified applicants with arrest and conviction records <h3> Stay connected <h3> Not ready to apply but want to be part of the Webflow community Consider following our story on our <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomblog rel=noopener noreferrer nofollow target=blank> Webflow Blog <a> <a class=fontbold underline fontbold underline fontbold underline href=httpswwwlinkedincomcompanywebflowinc rel=noopener noreferrer nofollow target=blank> LinkedIn <a> <a class=fontbold underline fontbold underline fontbold underline href=httpstwittercomwebflow rel=noopener noreferrer nofollow target=blank> X Twitter <a> andor <a class=fontbold underline fontbold underline fontbold underline href=httpswwwglassdoorcomReviewsWebflowReviewsE890506htm rel=noopener noreferrer nofollow target=blank> Glassdoor <a> <h3> Please note <h3> We will ensure that individuals with disabilities are provided reasonable accommodation to participate in the job application or interview process to perform essential job functions and to receive other benefits and privileges of employment Upon interview scheduling instructions for confidential accommodation requests will be administered To join Webflow youll need a valid right to work authorization depending on the country of employment If you are extended an offer that offer may be contingent upon your successful completion of a background check which will be conducted in accordance with applicable laws We may obtain one or more background screening reports about you solely for employment purposes For information about how Webflow processes your personal information please review <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomlegalapplicantprivacynotice rel=noopener noreferrer nofollow target=blank> Webflows Applicant Privacy Notice <a>

View Details Apply on workingnomads

Director - Data & AI

Company: TTEC Digital

Location: USA

Posted Apr 29, 2024

At TTEC Digital we coach clients to ensure their employees feel valued and fully supported because an amazing customer experience is an employee first process Our vision is the same a place where employees know they can thrive The Analytics Practice relies on Data Science Data Engineering and Marketing Analytic team members to equip our clients with the leading tools and datadriven insights needed to personalize and fuel exceptional experiences CX for their customers As the Director Data amp AI working remotely in the US or in a hybrid capacity in the Boston area you will serve as senior subject matter expert in the data amp analytics space for clients with the aim of crafting customer value maximizing growth or improving the business performance of our clients The Director Data amp AI role is a highly visible and strategic position where you will have the opportunity to develop a compelling vision for bringing actionable AIML solutions to our clients and advancing their digital transformations What youll be doing <ul> <li> Serve as senior subject matter expert in the data amp analytics space for clients with the aim of crafting customer value maximizing growth or improving the business performance of our clients <li> <li> Advise and partner with clients to solve their business problems with cloudbased modern data architectures and advanced analytics <li> <li> Develop a compelling vision for bringing actionable AIML solutions to our clients and advancing their digital transformations <li> <li> Develop Data and AI products to advance and enable the key mission outcomes for our clients <li> <li> Work closely with the sales and delivery teams to run presales efforts and engagements <li> <li> Collaborate on business development activities as a domain specialist for the Data and AI team across a variety of clients and industries <li> <li> Drive overall growth of practice through a combination of business development talent management oversight of delivery work and thought leadership <li> <li> Develop proposals presentations statement of work SOW and proactively recommend strategies to grow the data amp analytics practice presence in existing accounts <li> <li> Proactively identify internal and external dependencies issues scope changes and progress against project plan <li> <li> Review select and integrate nextgeneration technologies into the architectural strategy as needed <li> <li> Develop and expand our knowledge base and best practices for delivering data products <li> <li> Perform key leadership and mentorship role in the areas of advanced data techniques including data architecture data integration data governance ML and implementation in cloudbased and hybrid architectures <li> <li> Build and lead highperforming agile teams <li> <li> Devise talent strategy for the team identify resource gaps or inefficiencies build hiring plan recommend promotions and manage performance for consistency with the needs and vision of the department <li> <ul> What youll bring to us <ul> <li> Bachelors in Computer Science Engineering or other quantitative field with significant leadership experience <li> <li> 15+ years of demonstrated experience within data amp analytics <li> <li> 5+ years of experience in the consulting industry including technical presales expertise <li> <li> Experience in partner selling pipeline development GoToMarket strategies and management skills with attention to detail <li> <li> Experience leading teams of data engineers data scientists and data storytellers on largescale data projects <li> <li> Experience working on public cloud environments Azure GCP AWS and associated deep understanding of Data and ML tools offered <li> <li> Strong fundaments in data structures algorithms automated testing objectoriented programming performance complexity and implications of architecture on software performance <li> <li> A proven track record of using quantitative analysis to impact key business or product decisions <li> <li> A solid grasp of common statistical applications and methods AB tests and multivariate experiments probabilities regression <li> <li> Understanding of Agile Software Development Lifecycle and project planningexecution skills <li> <li> Desire to thrive in a constantly innovating and changing environment <li> <li> Strong skills in team leadership and networking ability to work across multiple organizations to accomplish diverse goals <li> <li> Exceptional presentation written and verbal communication skills <li> <li> Proven ability to understand the longterm big picture and shortterm perspective of situations <li> <ul> The anticipated range for individuals expressing interest in this position is $ 150K to $200K USD Actual compensation offers to a candidate may vary based on geographic location work experience education andor skill levels This position is eligible to participate in an annual incentive program Benefits available to eligible employees include Medical dental and vision Taxadvantaged healthcare accounts Financial and income protection benefits Paid time off PTO and wellness time off LIMS1 About Us TTEC Digital and our 1800+ employees pioneer engagement and growth solutions that fuel the exceptional customer experience CX Our sister company TTEC Engage is a 60000+ employee service company with customer service representatives located around the world TTEC Holdings Inc is the parent company for both Digital and Engage When clients have a holistic need they can draw from these independently managed centers of excellence TTEC Digital and TTEC Engage We are also delighted to share that TTEC has been awarded the Great Place To Work 20242025 certification based on outstanding employee experience across 14 countries TTEC is a proud equal opportunity employer where all qualified applicants will receive consideration for employment without regard to age race color religion sex sexual orientation gender identity national origin disability TTEC has fully embraced and is committed to expanding our diverse and inclusive workforce We strive to reflect the communities we serve while delivering amazing service and technology centered around humanity Rarely do applicants meet all desired job qualifications so if you feel you would succeed in the role above please take a moment and share your qualifications LIRemoteUS

View Details Apply on workingnomads

Account Executive - Enterprise

Company: Muck Rack

Location: USA

Posted Apr 30, 2024

Were growing quickly and were looking for a confident and driven Account Executive to join our team and introduce new prospects to Muck Rack win new business and contribute to our growth As an Account Executive you will be focused on winning new customers in the enterprise segment of Muck Rack You should be excited about working in a fastpaced environment with a diverse range of agency and brand prospects Youll be a great fit for this role if building rapport and guiding prospects through a sales process comes naturally to you <h2> What youll do <h2> <ul> <li> Serve as the primary point of contact for a portion of Muck Rack sales leads <li> <li> Achieve sales goals and meet activity quota requirements <li> <li> Respond to inbound demo requests and prospect for selfgenerated opportunities <li> <li> Demo Muck Rack at meetings on calls and at events <li> <li> Negotiate contracts and close deals <li> <ul> <h3> How success will be measured in this role <h3> <ul> <li> Individual revenue goal <li> <li> Pipeline generation and prospecting activity <li> <ul> <h2> If the details below describe you you could be a great fit for this role <h2> <ul> <li> At least 3 years of professional experience with 2 years of Account Executive experience in SaaS OR 4 yrs of PR experience <li> <li> Experience in a fullcycle sales role including lead generation pipeline management and closing opportunities <li> <li> Experience carrying a quota and exceeding goals or related experience <li> <li> Selfmotivated and driven by results <li> <li> Invested in personal development opportunities to drive your growth as a sales professional and industry expert <li> <li> Natural relationship builder who is personable patient and dependableyou enjoy working with prospects and they enjoy working with you <li> <li> Excellent communication skills both written and verbal you are comfortable leveraging email phone text and social media to engage with prospective customers as well as confident when presenting to large teams and groups <li> <li> Dedicated to understanding the challenges our customers are facing and identifying solutions that Muck Rack can provide <li> <li> Familiar with the tools we use including Google Drive Salesforce Slack LinkedIn Sales Navigator Gongio CPQ system and Guru willing to invest time in learning our tech stack to enable your own productivity and resourcefulness <li> <ul> <h3> Interview Overview <h3> Below youll find an outline of the interview plan for this role Please note that this is what we expect the process to look like we may ask you for supplemental information or require an additional step before making a final decision <ul> <li> 30 min interview with a member of our Talent Team <li> <li> A 1 hour zoom interview with the hiring manager <li> <li> Skills Assessment 2 hours max <li> <li> Peer interviews with several team members <li> <li> Final calls with executive team members <li> <ul> <h3> Salary <h3> In the US the base salary for this role is $80000 with on target earnings of $170000+ We take a geoneutral approach to compensation within the US meaning that we pay based on job function and level not location For all other countries we have competitive pay bands based on market standards Individual compensation decisions are based on a number of factors including experience level skillset and balancing internal equity relative to peers at the company We expect the majority of the candidates who are offered roles at our company to fall healthily throughout the range based on these factors We recognize that the person we hire may be less experienced or more senior than this job description as posted If that ends up being the case the updated salary range will be communicated with you as a candidate

View Details Apply on workingnomads

Account Executive (Manager/Director of Strategic Accounts)

Company: OfferFit

Location: USA

Posted Apr 30, 2024

Position Overview Were currently looking for a driven Account Executive ManagerDirector of Strategic Accounts to join our team In this role youll be responsible for winning and growing business for OfferFit by owning new and existing senior customer relationships In particular you will <ul> <li> Working closely with our business development amp marketing teams to create leads <li> <li> Lead discussions with potential new OfferFit customers <li> <li> Work with current and future OfferFit customers to determine the highestimpact applications of our AIsolution <li> <li> Participate in OfferFit POV motion to ensure they progress successfully working closely with OfferFits technical Implementation team <li> <li> Build amp own relationships with senior leaders at OfferFits customer companies eg CMOs CIOs <li> <li> Communicate customer needs to OfferFits product amp marketing teams ensuring a customercentric product roadmap <li> <ul> Why is it great <ul> <li> Be the face of the company working alongside our customers to help them succeed <li> <li> Sell a product with strong productmarket fit the pain of manual experimentation is a real pain point for marketers leading to a high level of enthusiasm for our products <li> <li> Get strong support from leadership OfferFit prioritizes sales helping your team succeed will be a true priority for the CEO and other Sales leadership team members <li> <li> Lead the AI transformation happening in marketing technology today OfferFit is at the forefront so youll be in the middle of the action <li> <li> Join OfferFits fastpaced supportive and professional team We make sure all of our team members are empowered and receive great mentorship and coaching <li> <ul> Whos a fit <ul> <li> Executionfocused leader you can structure a plan align stakeholders and see it through to execution <li> <li> People person you build trustbased relationships with internal team members and external partners and combine empathy with a willingness to have direct challenging conversations <li> <li> Processdriven you can create scalable frameworks to optimize the success of business outcomes <li> <li> Entrepreneurial you take initiative work around obstacles and always seek creative ways to get to the next level <li> <li> Technology enthusiast you are passionate about new technologies and their potential to impact businessasusual <li> <li> Clear communicator you are able to express yourself clearly and persuasively both in writing and speech <li> <li> Sales expert you have a history of enterprise sales and are wellversed in SPIN selling amp MEDDPICC qualification methodology <li> <ul> The base salary range for this position in the United States is $81000$142000 per year plus eligibility for additional commissionbonus ranging $91000$162000 with an overall OTE of $172000$305000 ability to earn more based on sales goals Eligibility for an additional end of year performance bonus commissions when applicable andor equity options may be provided as part of the compensation package in addition to a full range of medical financial andor other benefits depending on the position offered For nonUS based candidates base pay and overall compensation packages will be adjusted based on location Applicants should apply via OfferFits internal or external careers site OfferFit Benefits and Perks <ul> <li> Generous PTO starting at 25 days PTO per year and Parental leave policy 12 weeks paid <li> <li> 100 remote work environment with flexible hours <li> <li> Quarterly gatherings where we meet in person in a different city to work together bond as a team and celebrate our progress <li> <li> Weekly team events lunch and learns trivia virtual escape rooms town hall and team health barometer meetings <li> <li> Ability to learn and develop from an experienced leadership team exAmazon McKinsey BCG and IBM among others who are focused on building a talented diverse and inclusive tea <li> <li> Dedication to building a strong culture eg team resource groups weekly recognitions major life event celebrations mental healthsustainability days off etc <li> <li> US Only Competitive benefits major medical vision dental and LTD and 401K matching program <li> <ul>

View Details Apply on workingnomads

Breaking News Reporter

Company: Axios

Location: USA

Posted Apr 29, 2024

Quick Take Axios is a growthstage startup dedicated to providing trustworthy awardwinning news content in an audiencefirst format We are hiring a Breaking News Reporter Why it Matters The Breaking News Reporter role allows earlycareer journalists to put their journalism skills and instincts into practice by writing for our breaking news desk Youll report and aggregate breaking stories that are worthy of our readers time and occasionally report enterprise stories for Axios newsletters The Details The Breaking News Reporter will work closely with our team of editors on a SundayThursday schedule to determine appropriate breaking news stories to feature on Axioscom You will also have the opportunity to collaborate with beat reporters across the Axios newsroom on stories that intersect with our various coverage areas and on items for newsletters Ideal candidates should embody a passion for Axios and Smart Brevity an entrepreneurial spirit and possess the following skills <ul> <li> Exceptional news and editorial judgment and instincts <li> <li> Ability to write clear concise accurate copy <li> <li> Experience aggregating news stories and working in a breaking news environment <li> <li> Outstanding work ethic and comfort in a very fastpaced environment <li> <li> A reader of a wide variety of news and the ability to advance the daily news cycle forward with story pitches <li> <li> Eager to seek feedback and quick to incorporate feedback to grow and strengthen your skills <li> <li> Strong collaboration skills with journalists across all levels <li> <li> A working knowledge of US politics and media as well as an interest in political reporting is encouraged and an asset <li> <ul> What Axios brings to the table besides salary <ul> <li> 401k with employer match <li> <li> Robust PPO and High Deductible health insurance options on the Blue Cross Blue Shield network <li> <li> Employer Health Savings Account HSA contribution for the high deductible health plan option <li> <li> Dental and vision coverage <li> <li> Primary caregiver 12week paid leave <li> <li> Generous vacation policy plus holidays <li> <li> One mental health day per quarter <li> <li> Annual learning and development stipend <li> <li> $100 monthly workfromhome stipend <li> <li> Telemental health services through Headspace <li> <li> OneMedical membership including telehealth services <li> <li> Personal health advocacy resources through HealthAdvocate <li> <li> Inclusive fertility hormonal health and family forming benefits through Carrot Fertility <li> <li> Access to the Axios Family Fund which was created to allow employees to request financial support when facing financial hardship or emergencies <li> <li> Increased work flexibility for parents and caretakers <li> <li> Virtual companysponsored social events <li> <li> A strong and positive work environment <li> <li> A commitment to an open inclusive and diverse work culture <li> <ul> Pay for this role is in the range of $3365hour to $3845hour and is dependent on numerous factors including but not limited to location work experience and skills This range does not include other compensation benefits Please note that this role is a full time hourly nonexempt role that is eligible for overtime pay Equal Opportunity Employer Statement Axios is an equalopportunity employer that is committed to diversity and inclusion in the workplace We prohibit discrimination and harassment of any kind based on race color sex religion sexual orientation age gender identity gender expression veteran status national origin disability genetic information pregnancy or any other protected characteristic as outlined by federal state or local laws This policy applies to all employment practices within our organization including hiring recruiting promotion termination layoff recall leave of absence compensation benefits training and apprenticeship Axios makes hiring decisions based solely on qualifications merit and business needs at the time

View Details Apply on workingnomads

Previous
1
...
677
678
679
680
681
...
20508
Next

Frequently Asked Questions

What is the current demand for Retirement Plan roles in USA?

The demand for Retirement Plan positions in USA has risen by 12% over the past year, driven by companies expanding retirement benefits.

What salary range can I expect for a Senior Retirement Plan Analyst in USA?

A Senior Retirement Plan Analyst in USA typically earns between $85,000 and $110,000 annually, with bonuses and benefits adding up to 15% of base salary.

Which companies in USA offer the most competitive Retirement Plan roles?

Major tech firms in USA, such as Google, Microsoft, and Amazon, lead the market for Retirement Plan roles, offering competitive salaries, robust 401(k) matching, and comprehensive benefits.

All Retirement Plan Jobs 43,124 jobs All Jobs in USA 45,851 jobs Retirement Plan in Remote 249,429 jobs Retirement Plan in Other US Location 216,827 jobs Retirement Plan in New York City, NY 57,606 jobs Retirement Plan in Multiple Locations 51,716 jobs Retirement Plan in Washington DC 35,137 jobs Retirement Plan in Chicago, IL 33,954 jobs Travel in USA 79,958 jobs Full Time in USA 46,687 jobs 401(K) in USA 38,796 jobs Health Insurance in USA 36,248 jobs Life Insurance in USA 33,978 jobs Hospital in USA 32,028 jobs

Retirement Plan Jobs in USA

Frequently Asked Questions

Related Pages