Diversified Manufacturing Partner Jobs in USA
116,993 open positions · Updated daily
Looking for Diversified Manufacturing Partner jobs in USA? Browse our curated listings with transparent salary information to find the perfect Diversified Manufacturing Partner position in the USA area.
Client Development Director - Channel Partnerships
Company: StackAdapt
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> StackAdapt is a selfserve advertising platform that specializes in multichannel solutions including native display video connected TV audio ingame and digital outofhome ads We empower hundreds of digitallyfocused companies to deliver outcomes and exceptional campaign performance everyday StackAdapt was founded with a vision to be more than an advertising platform its a hub of innovation imagination and creativity <p> <p> <p> <p> Are you a proactive problem solver with a passion for programmatic advertising Are you a relationship builder with strong interpersonal communication skills If so then we want to hear from you Were looking for a Client Development Manager to join our expanding Channel Partnerships team in a specialist capacity <p> <p> <p> <p> You will become a foremost expert on the StackAdapt platform while owning the growth and success of enterprise level channel partners post sale The ideal candidate will manage a group of accounts with the goal of exceeding StackAdapts customer success standards building valuable relationships across executive and operator levels and driving new business using a consultative partner based sales approach <p> <p> <p> <p> Successful candidates will be self motivated with a strong track record of quickly understanding client technical needs and business objectives to recommend the right solutions to achieve goals <p> <p> <p> <p> StackAdapt is a Remote First company we are open to candidates located anywhere in the US for this position <p> <p> <p> <p> <p> <p> <strong> What youll be doing <strong> <p> <ul> <li> <p> Act as StackAdapts principle evangelist media thought leader problem solver and point of contact across your account portfolio <p> <li> <li> <p> Accurately forecast business needs and account growth while maintaining a clean pipeline of incremental opportunities <p> <li> <li> <p> Own build and run the rhythm of business across your portfolio through the use of status calls strategy calls office hours QBRs and more <p> <li> <li> <p> Identify and pitch key incremental sales opportunities develop client enablement plans and work cross functionally within StackAdapt to solve client needs and develop new opportunities <p> <li> <ul> <p> <p> <p> <strong> What youll bring to the table <strong> <p> <ul> <li> <p> High level of experience managing enterprise clients within the programmatic advertising space preferably at a Demand Side Platform Trading Desk or Media Agency <p> <li> <li> <p> Comfortable working within a quota based environment with a track record of exceeding targets and successfully growing account portfolios <p> <li> <li> <p> Positive energy proactive mentality highly organized with a growth mindset <p> <li> <li> <p> Bonus if you have worked with API based media clients at a Demand Side Platform <p> <li> <ul> <p> <p> <p> <strong> StackAdapters Enjoy <strong> <p> <ul> <li> <p> Competitive salary + commissions <p> <li> <li> <p> 401K matching <p> <li> <li> <p> 3 weeks vacation + 3 personal care days + 1 Culture amp Belief day + birthdays off <p> <li> <li> <p> Access to a comprehensive mental health care platform <p> <li> <li> <p> Health benefits from day one of employment <p> <li> <li> <p> Work from home reimbursements <p> <li> <li> <p> Optional global WeWork membership for those who want a change from their home office <p> <li> <li> <p> Robust training and onboarding program <p> <li> <li> <p> Coverage and support of personal development initiatives conferences courses etc <p> <li> <li> <p> Access to StackAdapt programmatic courses and certifications to support continuous learning <p> <li> <li> <p> Mentorship opportunities with industry leaders <p> <li> <li> <p> An awesome parental leave policy <p> <li> <li> <p> A friendly welcoming and supportive culture <p> <li> <li> <p> Our social and team events <p> <li> <ul> <p> <p> <p> <p> <p> <p> <p> <p> <p> <em> StackAdapt is a diverse and inclusive team of collaborative hardworking individuals trying to make a dent in the universe No matter who you are where you are from who you love follow in faith disability or superpower status ethnicity or the gender you identify with if youre comfortable let us know your pronouns you are welcome at StackAdapt If you have any requests or requirements to support you throughout any part of the interview process please let our Talent team know <em> <p> <p> <p> <p> <strong> About StackAdapt <strong> <p> <p> <p> <p> Weve been recognized for our diverse and supportive workplace high performing campaigns awardwinning customer service and innovation Weve been awarded <p> <p> <p> <p> <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpsblogstackadaptcomstackadaptnamedadagesbestplacetowork2024utmsource=linkedinamputmmedium=organicsocialamputmcampaign=adagesbestplacetowork2024amputmcontent=blog rel=noopener noreferrer nofollow target=blank> Ad Age Best Places to Work 2024 <a> <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpsblogstackadaptcomg22024bestsoftwareawards rel=noopener noreferrer nofollow target=blank> G2 Top Software and Top Marketing and Advertising Product for 2024 <a> <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpsblogstackadaptcom2023bestplacestoworkuk rel=noopener noreferrer nofollow target=blank> Campaigns Best Places to Work 2023 for the UK <a> <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpsblogstackadaptcombestworkplacesforwomenlist rel=noopener noreferrer nofollow target=blank> 2024 Best Workplaces for Women <a> and <a class=fontbold underline fontbold underline postingslink href=httpsblogstackadaptcom2023bestworkplacesincanadalist rel=noopener noreferrer nofollow target=blank> in Canada <a> by Great Place to Work® <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpswwwg2comproductsstackadaptreviews rel=noopener noreferrer nofollow target=blank> 1 DSP on G2 and leader in a number of categories including CrossChannel Advertising <a> <p> <p> <p> <p> LIRemote <p><p>
Sr. Technical Recruiter
Company: hims & hers
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <h3> <strong> About the Role <strong> <h3> <p> We are looking for a passionate and organized Remote Sr Technical Recruiter Contract to help us rapidly grow our Technical teams You will make a massive impact on the future of our company and wear many hats from building processes sourcing and closing candidates and working across various business functions Its an incredible time to join the Hims amp Hers team <p> <h3> <strong> You Will <strong> <h3> <ul> <li> <p> Manage full cycle recruiting process kickoff meetings with hiring managers sourcing candidate screens navigate interview loops facilitate panel debriefs offer stage and onboarding handoff <p> <li> <li> <p> Build a pipeline of talent by sourcing candidates across LinkedIn Recruiter internal referrals applicants and new channels <p> <li> <li> <p> Partner closely with leaders including executive leadership in the domains you support <p> <li> <li> <p> Meet weeklybi weekly with hiring managers to provide updates improve process and learn <p> <li> <li> <p> Use datadriven insights to improve recruiting efficiency and influence hiring decisions <p> <li> <li> <p> Obsess on exceptional candidate experience <p> <li> <li> <p> Cultivate a collaborative and constructive team environment exemplifying a lowego highhumility and partnershiporiented approach <p> <li> <ul> <h3> <strong> You Have <strong> <h3> <ul> <li> <p> 8+ years fullcycle technical recruiting for areas in Software Engineering Infrastructure Data and Analytics Product Management Data Science Machine learning and the Mobile domain <p> <li> <li> <p> 5+ years sourcing technical roles on LinkedIn Recruiter <p> <li> <li> <p> Interest to explore new places to source in addition to your goto channels <p> <li> <li> <p> Proven ability to work in a fastpaced environment and manage multiple requisitions simultaneously <p> <li> <li> <p> Experience with applicant tracking systems ATS and recruitment software Greenhouse <p> <li> <li> <p> Excellent communication and interpersonal skills with the ability to build rapport with candidates and hiring teams <p> <li> <ul> <h3> <strong> Our Tech Stack <strong> <h3> <ul> <li> <p> Frontend React React Native Typescript GraphQL <p> <li> <li> <p> Backend Java Kotlin Spring Boot SQL Python <p> <li> <li> <p> Automation Cypress Fastly Postman Javascript <p> <li> <li> <p> Monitoring Logging Datadog Elasticsearch Logstash Kibana <p> <li> <li> <p> Cloud AWS GCP <p> <li> <li> <p> CICD Jenkins CircleCi <p> <li> <li> <p> Database PostgreSQL DBT <p> <li> <li> <p> Containers Docker <p> <li> <ul> <p> <p> <p> <em> LIRemote <em> <p> <p> <p><p>
Director - Corporate FP&A
Company: Icertis
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> With unmatched technology and categorydefining innovation Icertis pushes the boundaries of whats possible with contract lifecycle management CLM The AIpowered analystvalidated Icertis Contract Intelligence ICI platform turns contracts from static documents into strategic advantage by structuring and connecting the critical contract information that defines how an organization runs Today the worlds most iconic brands and disruptive innovators trust Icertis to fully realize the intent of their combined 10 million contracts worth more than $1 trillion in 40+ languages and 93 countries <p> <p> <p> <p> <strong> Who we are <strong> Icertis is the only contract intelligence platform companies trust to keep them out in front now and in the future Our unwavering commitment to contract intelligence is grounded in our FORTE valuesFairness Openness Respect Teamwork and Executionwhich guide all our interactions with employees customers partners and stakeholders Because in our mission to be the contract intelligence platform of the world we believe how we get there is as important as the destination <p> <p> <p> <p> As the Director of FPampA you will play a critical leadership role you will work closely with all of companys functional leaders and bring key market strategic and operational insights that will shape the direction of the company and accelerate its growth You will also play a key role in telling the companys financial story to investors <p> <p> <p> <p> The ideal candidate will have a proven trackrecord of driving business outcomes through keen financial insight and business modeling They will have the ability to create a 360degree financial picture of the business that reflects and influences the companys strategy and be excellent at communicating with senior leaders and executives They will be toolsavvy with experience in creating scalable data and reporting solutions that support a datadriven culture LIRS1 <p> <p> <p> <p> <p> <p> <strong> What you will do <strong> <p> <ul> <li> <p> Formulate a robust 360degree financial picture of the business complete with market insights and operational drivers <p> <li> <li> <p> Develop and maintain the 3year Strategic Planning Model and forecast <p> <li> <li> <p> Deliver Global PampL and cash flow forecasts <p> <li> <li> <p> Drive Annual Planning Process work cross functionally to build and maintain the Annual Financial Plan and Departmental Budgets <p> <li> <li> <p> Build and deliver Business Performance ReportingOperating dashboards <p> <li> <li> <p> Perform strategic business analysis as needed MampA Geo Expansion <p> <li> <li> <p> Prepare financial analyses as needed to help drive improvements in the business Current focus areas include market expansion opportunities competitive benchmarking analyses pricing and strategic financial optimization strategies <p> <li> <li> <p> Partner with Controller to enhance and accelerate the financial reporting process <p> <li> <li> <p> Identifies and implements system and process improvements to increase the efficiency and effectiveness of planning and reporting workflows <p> <li> <li> <p> Prepare communications to Board of Directors <p> <li> <li> <p> Drive investor presentations and supporting analysis <p> <li> <li> <p> Develop a deep understanding of the business metrics with an eye towards understanding the benefits and risks from a financial perspective and helping to manage key business drivers and desired outcomes <p> <li> <li> <p> Play a key role in preparation of critical public financial documents to support the IPO process including working with bankers and supporting the production of investor materials and SEC filings eg S1 <p> <li> <ul> <p> <p> <p> <strong> What you will bring <strong> <p> <ul> <li> <p> 12+ years of experience of working in direct strategic analysis support of all aspects of the business at all areas of the PampL <p> <li> <li> <p> MBACPA or equivalent experience preferred <p> <li> <li> <p> Demonstrated complex modeling experience this is a handson role and managers are expected to directly contribute and lead by example <p> <li> <li> <p> Highly analytical detailoriented with a commitment to creating a highquality product Naturally inquisitive and able to extract information from various sources to identify and understand the underlying issue Not afraid to question results <p> <li> <li> <p> Prior success working in a fastpaced entrepreneurial environment takes initiative and works independently <p> <li> <li> <p> Working knowledge of accounting principles required including revenue recognition amortization and accrual vs cash accounting Must have a general understanding of financial statements <p> <li> <li> <p> Must have exceptional written visual and spoken communication skills <p> <li> <li> <p> Experience in preparing and delivering executive board and investor level communications <p> <li> <li> <p> IPO experience is a plus <p> <li> <li> <p> Must have advanced Excel Netsuite and Powerpoint skills <p> <li> <li> <p> Experience implementing financial analysis and planning tools required <p> <li> <ul> <p> <p> <p> <p> <p> $146000 $219000 a year <p> <p> <em> Pay offered will vary based on jobrelated factors such as location experience training skills and abilities In addition to the base salary and annual bonus target and an equity component is included in the compensation package <em> <p> <p> <strong> What we offer <strong> <p> <p> We are committed to the health and wellbeing of all Icertians their families the communities they live in and our customers This commitment is represented in the Icertis Four Rings of Responsibility Take Care of Self Take Care of Family Take Care of Community and Take Care of Business in that order <p> <p> <p> <p> To support these commitments Icertis offers excellent health and welfare benefits a generous 401k match and a robust paid time off program Here are some of the other reasons <a class=fontbold underline fontbold underline postingslink href=httpswwwicertiscomcompanynewsicertisplacesfirstinwashingtons100bestcompaniestoworkfor rel=noopener noreferrer nofollow target=blank> Icertis Places First in Washingtons 100 Best Companies to Work For | Icertis <a> <p> <p> <p> <p> ● Equity RSUs and shared ownership in the company <p> <p> ● Flexible work environment <p> <p> ● Paid maternity and paternity leave <p> <p> ● 7 Days for Humanity 7 paid volunteer days <p> <p> ● Generous holidays including the 4th of July week off paid <p> <p> ● Free professional and leadership coaching <p> <p> ● Annual personal development allowance <p> <p> <p> <p> Icertis Inc provides Equal Employment Opportunity to all employees and applicants for employment without regard to race color religion gender identity or expression sex sexual orientation national origin age disability genetic information marital status amnesty or status as a covered veteran in accordance with applicable federal state and local laws Icertis Inc complies with applicable state and local laws governing nondiscrimination in employment in every location in which the company has facilities If you are in need of accommodation or special assistance to navigate our website or to complete your application please send an email with your request to <a class=fontbold underline fontbold underline postingslink href=mailtocareersicertiscom rel=noopener noreferrer nofollow target=blank> careersicertiscom <a> or get in touch with your recruiter <p> <p> <p> <p> By submitting your application you acknowledge that you have read Icertiss Privacy Policy <a class=fontbold underline fontbold underline postingslink href=httpswwwicertiscomprivacystatement rel=noopener noreferrer nofollow target=blank> httpswwwicertiscomprivacystatement <a> <p> <p> <p> <p> Icertis is not open to third party solicitation or resumes for our posted FTE positions Resumes received from third party agencies that are unsolicited will be considered complimentary <p><p>
Brand Designer - Brand Studio
Company: Figma
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> Were seeking a Brand Designer to join the Figma Brand Studio a multidisciplinary group of designers makers and strategists This passionate team gives shape to the ways Figma shows up and interacts with the world through brand touchpoints marketing efforts and social channels This person will support our mission of delivering worldclass creative brand experiences and content that set the bar for quality We value those that are curious collaborative and egofree <p> <p> <p> <p> As a Brand Designer you will conceptualize and craft a variety of creative solutions across many mediums and surfaces including our website social channels and events This is a highly collaborative role where you will partner closely with GoToMarket teams giving shape to projects that build awareness of the Figma brand and product benefits in engaging and novel ways Working with the rest of the studio youll play an essential role in maintaining and evolving the Figma brand Youre a strong clear communicator and a natural problem solver providing a critical eye to the level of detail polish craft and consistency in our overall output The ideal candidate for this role is selfmotivated mediumagnostic willing to help out on any project loves a creative challenge and is excited about growing in their craft <p> <p> <p> <p> <em> This is a full time role that can be held from one of our US hubs or remotely in the United States <em> <p> <h3> What youll do at Figma <h3> <ul> <li> <p> See projects throughout the entire design process from creative conception to production <p> <li> <li> <p> Craft engaging visuals and digital experiences in a fastpaced environment <p> <li> <li> <p> Design for a wide range of projects while ensure consistency of the Figma brand across many surfaces including our website social channels and events <p> <li> <li> <p> Actively contribute to the evolution of the Figma brand by exploring novel solutions that support our brand and marketing goals <p> <li> <li> <p> Collaborate with marketing product design and growth teams to concept campaigns evergreen communications and launch announcements that support new products and features <p> <li> <ul> <h3> Wed love to hear from you if you have <h3> <ul> <li> <p> A strong portfolio showcasing brand experience across a range of mediums <p> <li> <li> <p> Excellence in typography color layout and composition <p> <li> <li> <p> Strong visual storytelling skills that support launching new and emerging product features in novel ways <p> <li> <li> <p> Deep understanding of current UIUX trends craft and patterns <p> <li> <li> <p> Effectively communicate concepts and design rationale <p> <li> <li> <p> Embrace an iterative design process and receptive to feedback <p> <li> <li> <p> Able to work independently drive multiple projects at a time and iterate quickly <p> <li> <li> <p> Foster strong working relationships with team members and crossfunctional partners <p> <li> <li> <p> Comfortable in your soft skills listening negotiating and decisionmaking <p> <li> <ul> <p> At Figma one of our values is Grow as you go We believe in hiring smart curious people who are excited to learn and develop their skills If youre excited about this role but your past experience doesnt align perfectly with the points outlined in the job description we encourage you to apply anyways You may be just the right candidate for this or other roles <p><p>
Machine Learning Engineer (L3)
Company: Twilio
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <h3> <strong> See yourself at Twilio <strong> <h3> <p> Join the team as Twilios next Machine Learning Engineer L3 on the Data Services and Throughput team <p> <h3> <strong> Who we are amp why were hiring <strong> <h3> <p> Twilio powers realtime business communications and data solutions that help <a class=fontbold underline fontbold underline fontbold underline href=httpscustomerstwiliocom rel=noopener noreferrer nofollow target=blank> companies and developers worldwide <a> build better applications and customer experiences <p> <p> Although were headquartered in San Francisco we have presence throughout South America Europe Asia and Australia Were on a journey to becoming a global company that actively opposes racism and all forms of oppression and bias At Twilio we support <a class=fontbold underline fontbold underline fontbold underline href=httpswwwtwiliocomcompanydiversity rel=noopener noreferrer nofollow target=blank> diversity equity amp inclusion <a> wherever we do business <p> <h3> <strong> About the job <strong> <h3> <p> This position is needed to to drive the innovation and creation of cuttingedge products that serve the needs of developers builders and operators You will be a crucial bridge between Product and Design tasked with developing evaluating and maintaining scalable Machine Learning models within lowlatency for realtime applications Your collaboration and expertise will be fundamental in delivering robust solutions that power our users success You will be closely working with a crossfunctional team of engineers architects product UIUX and partners to develop ML and data driven algorithm aspects of customer facing products in Twilio Communication applications <p> <p> Twilio Communications is the leading software for sending messages programmatically The Data Services and Throughput organization builds AIenabled capabilities that separate Twilio from its competitors in messaging capabilities <p> <h3> <strong> Responsibilities <strong> <h3> <p> In this role youll <p> <ul> <li> <p> Build and maintain scalable high quality machine learning solutions in production <p> <li> <li> <p> Design and implement tools and procedures to evaluate performance and accuracy of models and data <p> <li> <li> <p> Work closely with software engineers build tools to enhance productivity and to ship and maintain ML models <p> <li> <li> <p> Demonstrate endtoend understanding of applications and why behind models amp systems and develop high quality MLbased software at scale <p> <li> <li> <p> Truly own the product you work on Be responsible for SLA on call incident resolution customer feedback and participate in blameless postmortems to make our products better <p> <li> <li> <p> Partner with product managers tech leads and stakeholders to analyze business problems clarify requirements and define the scope of the systems and leverage stateoftheart Statistics Machine Learning Deep Learning and Gen AI to address the business problems <p> <li> <li> <p> Drive high engineering standards on the team through code review automated testing and mentoring <p> <li> <li> <p> Collaborate and brainstorm product ideas with product managers designers and engineers <p> <li> <ul> <h3> <strong> Qualifications <strong> <h3> <p> Not all applicants will have skills that match a job description exactly Twilio values diverse experiences in other industries and we encourage everyone who meets the required qualifications to apply While having desired qualifications make for a strong candidate we encourage applicants with alternative experiences to also apply If your career is just starting or hasnt followed a traditional path dont let that stop you from considering Twilio We are always looking for people who will bring something new to the table <p> <p> <strong> Required <strong> <p> <ul> <li> <p> 4+ years of applied ML experience <p> <li> <li> <p> Strong background in the foundations of machine learning and building blocks of modern deep learning <p> <li> <li> <p> Proficiency in Python or Java and familiarity with design patterns <p> <li> <li> <p> Track record of building shipping and maintaining machine learning models in production <p> <li> <li> <p> Extensive experience in technologies such as PyTorch Tensorflow Scikitlearn Spacy NLTK application frameworks eg Flask <p> <li> <li> <p> Deep understanding of ML model implementation cycle eg feature engineering trainingserving AB test model selection etc algorithms eg xgboost time series models deep learning graph neural networks optimization and domains eg forecasting personalization and recommendation system NLP embedding representation <p> <li> <li> <p> Familiarity with MLOps concepts related and maintaining models in production such as testing versioning model registry retraining and monitoring <p> <li> <li> <p> Demonstrated ability to ramp up understand and operate effectively in new application business domains <p> <li> <li> <p> Good written and verbal communication skills You are confident in writing down and presenting your designs and decisions throughout the development lifecycle You are also comfortable providing and receiving feedback in an Agile environment <p> <li> <ul> <p> <strong> Desired <strong> <p> <ul> <li> <p> Experience in recommendation systems forecasting models NLP techniques embedding representation approaches and statistical models <p> <li> <li> <p> Experience with Retrieval Augmented Generation Large Language Models and prompt engineering <p> <li> <li> <p> Knowledge of Java and system design concepts <p> <li> <li> <p> Understanding of Experience with CICD pipelines and automated deployment processes <p> <li> <li> <p> Experience with either AWS Azure or Google Cloud and technologies such as Spark Kafka Kubeflow GPU <p> <li> <ul> <h3> <strong> Location <strong> <h3> <p> This role will be and based in the US but is not eligible to be hired in NY WA CT CA and PA <p> <h3> <strong> Travel <strong> <h3> <p> We prioritize connection and opportunities to build relationships with our customers and each other For this role you may be required to travel occasionally to participate in project or team inperson meetings <p> <h3> <strong> What We Offer <strong> <h3> <p> There are many benefits to working at Twilio including in addition to competitive pay things like generous timeoff ample parental and wellness leave healthcare a retirement savings program and much more Offerings vary by location <p> <h3> <strong> Twilio thinks big Do you <strong> <h3> <p> We like to solve problems take initiative pitch in when needed and are always up for trying new things Thats why we seek out colleagues who embody our values something we call <a class=fontbold underline fontbold underline fontbold underline href=httpswwwtwiliocomcompanyvalues rel=noopener noreferrer nofollow target=blank> Twilio Magic <a> Additionally we empower employees to build <a class=fontbold underline fontbold underline fontbold underline href=httpstwilioorgsupportandresourcesimpactfund rel=noopener noreferrer nofollow target=blank> positive change in their communities <a> by supporting their volunteering and donation efforts <p> <p> So if youre ready to unleash your full potential do your best work and be the best version of yourself apply now <p> <p> If this role isnt what youre looking for <a class=fontbold underline fontbold underline fontbold underline href=httpswwwtwiliocomcompanyjobsopenpositions rel=noopener noreferrer nofollow target=blank> please consider other open positions <a> <p> <p> <em> Please note this role is open to candidates outside of Colorado California New York and Washington The information below is provided for candidates hired in those locations only <em> <p> <p> The estimated pay ranges for this role are as follows <p> <ul> <li> <p> Based in Colorado $13500 $169000 <p> <li> <li> <p> This role may be eligible to participate in Twilios equity plan and corporate bonus plan All roles are eligible for the following benefits health care insurance 401k retirement account paid sick time paid personal time off paid parental leave <p> <li> <ul> <p> The successful candidates starting salary will be determined based on permissible nondiscriminatory factors such as skills experience and geographic location within the state <p> <p> <strong> Twilio is proud to be an equal opportunity employer <strong> Twilio is proud to be an Equal Employment Opportunity and Affirmative Action employer We do not discriminate based upon race religion color national origin sex including pregnancy childbirth reproductive health decisions or related medical conditions sexual orientation gender identity gender expression age status as a protected veteran status as an individual with a disability genetic information political views or activity or other applicable legally protected characteristics We also consider qualified applicants with criminal histories consistent with applicable federal state and local law Additionally Twilio participates in the EVerify program in certain locations as required by law <p> <p> Twilio is committed to providing reasonable accommodations for qualified individuals with disabilities and disabled veterans in our job application procedures If you need assistance or an accommodation due to a disability please contact us at accommodationtwiliocom <p><p>
Product Design Manager, Tax Credits
Company: Gusto, Inc.
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> Product Design at Gusto is made up of over 60 creative collaborative people who care deeply about our mission to empower small businesses and their employees Were a crossfunctional bunch focused on Design Research Writing Ops and Frontend Development who are always looking for opportunities to build understanding and empathy for the people who use Gusto We dont care a whole lot about swim lanes and we work closely with our partners in Product Engineering Data and Marketing to design build and ship experiences that make a difference We are passionate advocates for thoughtful crafted and inclusive experiences and we believe great design can make hard things possible even delightful <a class=fontbold underline fontbold underline fontbold underline href=httpsgustodesignnotionsiteDesignthefutureofworkatGusto1208931e36ae4da399ea4fa43f11b1e1 rel=noopener noreferrer nofollow target=blank> Read more about Design at Gusto <a> <p> <p> <strong> About the team <strong> <p> <p> At Gusto were dedicated to simplifying the complex world of business operations As a powerful People Platform we offer a comprehensive suite of essential products including payroll benefits time tracking and more all designed to streamline processes and empower businesses to thrive Our commitment to worldclass customer experience sets us apart <p> <p> Our Tax Credits team at Gusto is bringing to life an emerging market product for our customers We aim to help guide them through intricate tax credit regulations unlock financial opportunities and extend the runway for their businesses The Tax Credits team has ambitious goals to drastically simplify and demystify the complex world of tax credits in order to drive significant customer value and revenue for our business <p> <p> <strong> About the opportunity <strong> <p> <p> As the Product Design Manager for the Tax Credits team youll lead a small team of product designers to craft high quality and intuitive endtoend experiences for our customers Youll leverage your strategic business acumen to partner with senior crossfunctional leaders to plan and drive the roadmap and multiyear vision The work on Tax Credits is high visibility high impact experiences that balance complex technical and compliance requirements Your leadership will play a pivotal role in simplifying the intricate journey of discovering and securing tax credits ensuring its approachable userfriendly and stressfree <p> <p> <strong> Heres what youll do daytoday <strong> <p> <ul> <li> <p> Develop a deep understanding of the different customers we serve and how their varying needs translate into product requirements <p> <li> <li> <p> Work with crossfunctional partners in Product Management Engineering and Data Science to understand customer problems and identify key opportunities for the customer and our business Youll be the design representative on the senior quartet <p> <li> <li> <p> Empower a small team of product designers creating the conditions for them to do work theyre proud of and that serves the needs of our customers <p> <li> <li> <p> Craft the endtoend journeys and develop frameworks and principles that can be used to help align our teams on the right experiences <p> <li> <li> <p> Collaborate with our Research Data Science and Customer Support teams to build a holistic understanding of customer needs and make sure theyre shared with your teams to inform their thinking build empathy and inform prioritization decisions <p> <li> <li> <p> Collaborate with other key teams and stakeholders at Gusto such as Legal Compliance Risk Operations and other various product owners <p> <li> <li> <p> Ensure that proposed solutions are customerinformed through research data and insights from our Customer Support team <p> <li> <li> <p> Balance an iterative approach and urgency to solve customer pain with ensuring that short term improvements ladder up to longterm vision and meet a high bar for the customer experience <p> <li> <li> <p> Hold high standards for the customer experience including partnering with engineering partners to refine the end customer experience and ensure that what we release is bug free performant accessible and responsive <p> <li> <li> <p> Drive solutions that establish Gusto as a trusted tax expert advisor empowering our customers to make confident and informed tax credit decisions <p> <li> <li> <p> Identify emerging technologies and industry trends build business cases and define product vision and strategy <p> <li> <li> <p> Youll drive teamwide impact through leadership coaching and fostering a culture of growth and collaboration <p> <li> <ul> <p> <strong> Heres what were looking for <strong> <p> <ul> <li> <p> 8+ years Product Design experience with at least 2 of those years being in management roles <p> <li> <li> <p> Ideally youve worked on enabling simple easy to use experiences in complex domains like payroll benefits finance or banking etc Bonus if you have direct experience working on tax andor accounting products <p> <li> <li> <p> A track record of upleveling direct reports and raising the bar for design quality within an organization <p> <li> <li> <p> A proven track record of designing great UX for complex workflows and crafting endtoend experience visions and frameworks while showcasing an iterative approach toward execution <p> <li> <li> <p> A customerfocused mindset and can speak to the impact of the experience theyve shipped in tangible terms the business understands <p> <li> <li> <p> Strong opinions loosely held and a willingness to engage in constructive debates about scope and tradeoffs to build alignment and unblock workYouve built great relationships with cross functional collaborators and know how to model this for your team <p> <li> <li> <p> A proven track record of designing great UX for complex workflows and crafting endtoend experience visions and frameworks while showcasing an iterative approach toward execution <p> <li> <li> <p> A customerfocused mindset and can speak to the impact of the experience theyve shipped in tangible terms the business understands <p> <li> <li> <p> Strong opinions loosely held and a willingness to engage in constructive debates about scope and tradeoffs to build alignment and unblock workYouve built great relationships with cross functional collaborators and know how to model this for your team <p> <li> <li> <p> Communication and collaboration skills that enable you to explain the impact of your work tradeoffs youve made lessons learned and design rationale and generate alignment and enthusiasm across the company <p> <li> <li> <p> Ability to embrace ambiguous situations as opportunities to add clarity <p> <li> <li> <p> A builder who loves being hands on crafting high quality high impact solutions directly and through pairing with more junior team members <p> <li> <ul> <p> At Gusto we strive to provide rewards that empower employees to achieve their financial and personal goals We offer competitive compensation packages with a strong emphasis on equity based compensation ownership in Gusto To learn more about Gustos compensation philosophy and benefits offerings please view our <a class=fontbold underline fontbold underline fontbold underline href=httpsgustocomaboutcareerstotalrewards rel=noopener noreferrer nofollow target=blank> Total Rewards Approach page <a> <p> <p> Our cash compensation range for this role is $152000yr to $232000yr in Denver amp most remote locations and $185000yr to $251000yr in San Francisco amp New York Final offer amounts are determined by multiple factors including candidate experience and expertise and may vary from the amounts listed above <p><p>
Software Technical Program Manager
Company: Groq
Location: USA
Posted Apr 29, 2024
Groq is a company that envisions an AI economy powered by human agency, aiming to make AI accessible to all. They believe the current GPU technology is limiting AI applications and have introduced the Language Processing Unit (LPU) Inference Engine, which outperforms GPUs in speed, power, efficiency, and cost-effectiveness. The company is hiring a Software Technical Program Manager to guide software teams, improve collaboration between development and production teams, and work cross-functionally with hardware teams. The ideal candidate should be self-motivated, have experience in software engineering, and be comfortable working in a dynamic environment. Groq values diversity and inclusion, offering competitive compensation and benefits.
Performance Marketing Channel Manager - Email | SMS
Company: Stio
Location: USA
Posted Apr 29, 2024
Stio is an outdoor mountain brand based in Jackson, Wyoming, known for its functional and innovative apparel, footwear, and accessories. The company is committed to sustainability, partnering with organizations like Protect Our Winters and the Conservation Alliance. Stio is seeking a Performance Marketing Channel Manager - Email | SMS to drive customer acquisition, retention, and revenue through email and SMS marketing. The role involves setting and achieving channel marketing goals, analyzing retention metrics, and collaborating with various teams to develop and deliver multi-channel marketing programs. The ideal candidate should have 3+ years of email or related channel management experience, proficiency in Microsoft Office and Google products, and a strong understanding of Klaviyo or similar email platforms.
Senior Backend Engineer - Styles
Company: Webflow
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> At Webflow our mission is to bring development superpowers to everyone Webflow is the leading visual development platform for building powerful websites without writing code By combining modern web development technologies into one platform Webflow enables people to build websites visually saving engineering time while clean code seamlessly generates in the background From independent designers and creative agencies to Fortune 500 companies millions worldwide use Webflow to be more nimble creative and collaborative Its the web made better <p> <p> The Styles team is responsible for building and investing in the design capabilities of our core product to empower millions of designers worldwide to easily adopt Webflow to build manage and scale any number of sites efficiently <p> <p> Were looking for a Senior Backend Engineer to join the Styles team and lead the team to deliver impactful features for our customers to build highly personalized web experiences In this role you will execute the technical direction and be a mentor amp partner to other engineers on the team Additionally you will help lead crossfunctional efforts to drive even greater impact <p> <h2> <strong> About the role <strong> <h2> <ul> <li> <p> Location Remotefirst United States BC amp ON Canada <p> <li> <li> <p> Fulltime <p> <li> <li> <p> Permanent <p> <li> <li> <p> Exempt US Candidates <p> <li> <li> <p> Reporting to the Engineering Manager of Designer UX team <p> <li> <li> <p> The cash compensation for this role is tailored to align with the cost of labor in different geographic markets Weve structured the base pay ranges for this role into zones for our geographic markets and the specific base pay within the range will be determined by the candidates geographic location jobrelated experience knowledge qualifications and skills <p> <ul> <li> <p> Zone A $162500 $216050 <p> <li> <li> <p> Zone B $152700 $203100 <p> <li> <li> <p> Zone C $143000 $190150 <p> <li> <ul> <ul> <li> <p> CAD 184600 CAD 245500 <p> <li> <ul> <ul> <li> <p> United States all figures cited below in USD and pertain to workers in the United States <p> <li> <li> <p> Canada All figures cited below in CAD and pertain to workers in ON amp BC Canada <p> <li> <ul> <li> <ul> <p> Please visit our <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowaboutwebflowiocareers rel=noopener noreferrer nofollow target=blank> Careers page <a> for more information on which locations are included in each of our geographic pay zones However please confirm the zone for your specific location with your recruiter <p> <p> As a Senior Backend Engineer youll <p> <ul> <li> <p> Design and implement scalable backend services <p> <li> <li> <p> Drive crosspillar collaboration with software engineers product managers designers and QA analysts in an autonomous supportive team environment <p> <li> <li> <p> Effectively communicate team priorities and strategy to engineering and crossfunctional leadership teams <p> <li> <li> <p> Build and maintain unit and integration tests <p> <li> <li> <p> Provide clarity on processes and priorities to crosspillar partners and other engineers on the team <p> <li> <li> <p> Mentor other engineers on best practices code design considerations and quality <p> <li> <ul> <p> In addition to the responsibilities outlined above at Webflow we will support you in identifying where your interests and development opportunities lie and well help you incorporate them into your role <p> <h2> <strong> About you <strong> <h2> <p> Youll thrive as a Senior Backend Engineer Styles if you <p> <ul> <li> <p> Have 5+ years of experience in scalable multitenant environments <p> <li> <li> <p> Have 2+ years experience working with feature teams on customerfacing products shipping and iterating to solve customer problems <p> <li> <li> <p> Value testing and documentation equally as much as your code <p> <li> <li> <p> Are comfortable with ambiguity and scoping solutions with your teammates <p> <li> <li> <p> Are comfortable working on JavascriptTypescript MongoDB and Node <p> <li> <li> <p> Have consistently communicated trade offs throughout a project to meet both technical and business requirements <p> <li> <li> <p> Enjoy highvisibility work and presenting to executive counterparts <p> <li> <li> <p> Get excited about encouraging and developing other engineers <p> <li> <ul> <p> Even if you dont meet 100 of the above qualifications you should still seriously consider applying Research shows that you may still be considered for a role if you meet just half of the requirements <p> <p> <strong> Our Core Behaviors <strong> <p> <ul> <li> <p> <strong> Obsess over customer experience <strong> We deeply understand what were building and who were building for and serving We define the leading edge of whats possible in our industry and deliver the future for our customers <p> <li> <li> <p> <strong> Move with heartfelt urgency <strong> We have a healthy relationship with impatience channeling it thoughtfully to show up better and faster for our customers and for each other Time is the most limited thing we have and we make the most of every moment <p> <li> <li> <p> <strong> Say the hard thing with care <strong> Our best work often comes from intelligent debate critique and even difficult conversations We speak our minds and dont sugarcoat things and we do so with respect maturity and care <p> <li> <li> <p> <strong> Make your mark <strong> We seek out new and unique ways to create meaningful impact and we champion the same from our colleagues We work as a team to get the job done and we go out of our way to celebrate and reward those going above and beyond for our customers and our teammates <p> <li> <ul> <h3> <strong> Benefits amp wellness <strong> <h3> <ul> <li> <p> Equity ownership RSUs in a growing privatelyowned company <p> <li> <li> <p> 100 employerpaid healthcare vision and dental insurance coverage for employees and dependents fulltime employees working 30+ hours per week as well as Health Savings AccountHealth Reimbursement Account dependent care Flexible Spending Account US only dependent on insurance plan selection where applicable in the respective country of employment Employees may also have voluntary insurance options such as life disability hospital protection accident and critical illness where applicable in the respective country of employment <p> <li> <li> <p> 12 weeks of paid parental leave for both birthing and nonbirthing caregivers as well as an additional 68 weeks of pregnancy disability for birthing parents to be used before child bonding leave where local requirements are more generous employees receive the greater benefit Employees also have access to family planning care and reimbursement <p> <li> <li> <p> Flexible PTO with a mandatory annual minimum of 10 days paid time off for all locations where local requirements are more generous employees receive the greater benefit and sabbatical program <p> <li> <li> <p> Access to mental wellness and professional coaching therapy and Employee Assistance Program <p> <li> <li> <p> Monthly stipends to support health and wellness smart work and professional growth <p> <li> <li> <p> Professional career coaching internal learning amp development programs <p> <li> <li> <p> 401k plan and pension schemes in countries where statutorily required financial wellness benefits like CPA or financial advisor coverage <p> <li> <li> <p> Discounted Pet Insurance offering US only <p> <li> <li> <p> Commuter benefits for inoffice employees <p> <li> <ul> <p> <em> Temporary employees are not eligible for paid holiday time off accrued paid time off paid leaves of absence or companysponsored perks unless otherwise required by law <em> <p> <h3> <strong> Be you with us <strong> <h3> <p> At Webflow equality is a core tenet of our culture We are an Equal Opportunity EEOVeteransDisabled Employer and are <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomdiversityequityinclusion rel=noopener noreferrer nofollow target=blank> committed <a> to building an inclusive global team that represents a variety of backgrounds perspectives beliefs and experiences Employment decisions are made on the basis of jobrelated criteria without regard to race color religion sex sexual orientation gender identity national origin disability veteran status or any other classification protected by applicable law Pursuant to the San Francisco Fair Chance Ordinance Webflow will consider for employment qualified applicants with arrest and conviction records <p> <h3> <strong> Stay connected <strong> <h3> <p> Not ready to apply but want to be part of the Webflow community Consider following our story on our <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomblog rel=noopener noreferrer nofollow target=blank> Webflow Blog <a> <a class=fontbold underline fontbold underline fontbold underline href=httpswwwlinkedincomcompanywebflowinc rel=noopener noreferrer nofollow target=blank> LinkedIn <a> <a class=fontbold underline fontbold underline fontbold underline href=httpstwittercomwebflow rel=noopener noreferrer nofollow target=blank> X Twitter <a> andor <a class=fontbold underline fontbold underline fontbold underline href=httpswwwglassdoorcomReviewsWebflowReviewsE890506htm rel=noopener noreferrer nofollow target=blank> Glassdoor <a> <p> <h3> <strong> Please note <strong> <h3> <p> <em> We will ensure that individuals with disabilities are provided reasonable accommodation to participate in the job application or interview process to perform essential job functions and to receive other benefits and privileges of employment Upon interview scheduling instructions for confidential accommodation requests will be administered <em> <p> <p> <em> To join Webflow youll need a valid right to work authorization depending on the country of employment <em> <p> <p> <em> If you are extended an offer that offer may be contingent upon your successful completion of a background check which will be conducted in accordance with applicable laws We may obtain one or more background screening reports about you solely for employment purposes <em> <p> <p> <em> For information about how Webflow processes your personal information please review <em> <a class=fontbold underline fontbold underline fontbold underline href=httpswebflowcomlegalapplicantprivacynotice rel=noopener noreferrer nofollow target=blank> <em> Webflows Applicant Privacy Notice <em> <a> <em> <em> <p><p>
Principal Engineer
Company: TeamSnap
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> <strong> 🌎 About Us <strong> <p> <p> At TeamSnap we believe when the world connects through sports the world becomes better TeamSnap is a sports and communication platform dedicated to taking the work out of play in youth sports We also believe our jobs should excite us our teammates should support us and our bosses should inspire us We empower our people to bring big ideas and tiny egos landing us on Outside Magazines list of <strong> Best Places to Work <strong> and Built Ins <strong> 100 Best RemoteFirst Places to Work <strong> <p> <p> <p> <p> TeamSnap is seeking a Principal Engineer who will report directly to the VP Engineering and Chief Architect to help define lead and drive our technological evolution As a technology leader youll shape our engineering culture in a positive direction with transparency and collaboration by mentoring leading and pairing with teams to evolve their practices and technical vision <p> <p> <p> <p> <p> <p> <strong> What youll be doing <strong> <p> <ul> <li> <p> Execute on the establishment of reference architecture and domain models <p> <li> <li> <p> Influence evolution of developer tooling and experience <p> <li> <li> <p> Help drive the definition of emerging technical and architectural strategies <p> <li> <li> <p> Supporting execution of critical projects via joining scrum teams as an additive team member ensuring the continuity of deliverables beyond scrum team interaction <p> <li> <li> <p> Ensure strong documentation of all systementerprise architecture as well as ancillary collateral such as sequence diagrams eventing orchestration layers and interoperability <p> <li> <li> <p> Define and own core KPIs to track the maintainability and effectiveness of our architecture and technology <p> <li> <li> <p> Encourage innovation creative thought and new ideassolutions <p> <li> <li> <p> Work with department leaders to identify shape and capture strategic technical work <p> <li> <li> <p> Being a strong partner and goto person for all engineering teams <p> <li> <li> <p> Contributing to engineeringwide goals priorities and improvements <p> <li> <li> <p> Consistently and systemically rallying inspiring and empowering all teams to do their best work ever <p> <li> <ul> <p> <p> <p> <strong> Whatll set you up for success <strong> <p> <ul> <li> <p> Experience leading and driving engineering departmentwide change during an evolutionary period of rapid growth and change while serving as a role model for an inclusive engineering culture <p> <li> <li> <p> Experience supporting both product and platform engineering teams as well as familiarity with our tech stack Google Cloud Platform Kubernetes Docker Terraform Datadog Elixir Typescript Golang <p> <li> <li> <p> Experience working across crossfunctional teams to foster a culture of priority setting and urgency in alignment with organizational strategy <p> <li> <li> <p> Deep experience in at least one of the following frontend web architecture mobile development platforms serverless and serverfull hybrid cloud architectures industryleading developer experience automation and tooling <p> <li> <li> <p> Youre comfortable working with nontechnical senior leaders and can convey complex technical topics to them in an approachable manner inviting collaborative discussion while also sweating and diving into the details whenever necessary getting your hands dirty and diving into code with any engineers across our department <p> <li> <li> <p> Ideally you have strong experience at Codenames we play every two weeks <p> <li> <ul> <p> <p> <p> <p> <p> Got cold feet If youre thinking you dont meet 100 of the above qualifications <strong> you should still seriously consider applying <strong> Were all humans with special talents that go beyond whats listed here <p> <p> <p> <p> <strong> Compensation <strong> <p> <p> Were committed to equitable compensation for all TeamSnappers The salary for this role starts at a minimum of $170000 inclusive of bonus and benefits Compensation is adjusted based on work experience skills certifications and geographic location Comp is highly competitive nationwide so please dont hesitate to apply <p> <p> <p> <p> <strong> 🖥 Location <strong> <p> <p> TeamSnap is a fully remote company so you need to be very comfortable working with people who arent in the same time zone as you We are always expanding but there is a small list of states we do not hire in including Alabama Alaska Delaware District of Columbia Hawaii Iowa Louisiana Mississippi Nebraska New Mexico Rhode Island South Dakota and West Virginia and while we love all parts of the world we can only hire permanent US residents at this time <p> <p> <p> <p> <strong> 🚀 Opportunities to Grow <strong> <p> <p> At TeamSnap we work hard to provide a culture of trust accountability inclusivity and boundless opportunities to grow along with the chance to make a lasting impact and have some fun while doing it <p> <p> <p> <p> <strong> 🎩 Total Rewards <strong> <p> <p> Were proud to be <a class=fontbold underline fontbold underline postingslink href=httpswwwinccommattgiventhisstartupceospolicyonworkingremotelyisgeniusanditsbasedonafamoustvshowhtml rel=noopener noreferrer nofollow target=blank> <strong> remotefirst <strong> <a> <strong> <strong> Weve been remote since 2009 long before COVID made it cool <p> <p> Unlimited PTO and paid parental leave for ALL parents not just primary or secondary <p> <p> 100 premium coverage of medicaldentalvision for you and your family <p> <p> 401K to help you invest for the future <p> <p> $1500 annual learning and development stipend <p> <p> Travel to fun locations for allcompany meetings and team events <p> <p> Generous home office allowance to set you up for success <p> <p> TeamSnap SWAG to our <a class=fontbold underline fontbold underline postingslink href=httpsteamlockersquadlockercomlockersteamsnap401580 rel=noopener noreferrer nofollow target=blank> store <a> upon starting and a $50 credit on every work anniversary thereafter <p> <p> A monthly stipend reimbursement for health amp wellness and so much more <p> <p> <a class=fontbold underline fontbold underline postingslink href=httpsdocsgooglecompresentationd1oER8pxhc3zkKRDigScyXd6nQWVNFPV6HwATawDsGhukeditslide=idg22b26eb773f1392 rel=noopener noreferrer nofollow target=blank> TeamSnap Total Rewards <a> <p> <p> <p> <p> 🏆 <strong> Working at TeamSnap <strong> <p> <p> At TeamSnap youre not a culture fit youre a culture add Check out our <a class=fontbold underline fontbold underline postingslink href=httpswwwcanvacomdesignDAE4bjYNX4xtJEKWBDcTWpSARgrKMAoAviewutmcontent=DAE4bjYNX4amputmcampaign=designshareamputmmedium=linkamputmsource=publishsharelink1 rel=noopener noreferrer nofollow target=blank> <strong> Culture Playbook <strong> <a> and learn how we succeed at being remotefirst what makes our company so unique and how were inspired by our people our customers and our values <p> <p> <p> <p> <strong> 🧡 Inclusion and Diversity <strong> <p> <p> Creativity and innovation cant thrive when were cookiecutter images of each other Were quickly growing more diverse but theres always room for improvement We are committed to inclusion and diversity at TeamSnap and we hold ourselves accountable for building an environment where everyone feels valued If you need any disabilityrelated adaptation during the recruitment process just let us know We are an Equal Employment Opportunity Employer <p><p>
Payor Success & Relations Partnerships Manager
Company: Grow Therapy
Location: USA
Posted Apr 30, 2024
<p class=jobDescription> <p> <strong> What Youll Be Doing <strong> <p> <p> Were looking for an experienced Partnerships Manager for our Insurance Operations team who is passionate about improving the landscape for mental healthcare You will lead our strategic partnerships with insurance companies within our Payor Success and Relations department You will be responsible for developing and strengthening relationships with new and existing partners as well as executing on new and existing engagement opportunities You will also play an essential role as liaison in ensuring that our credentialing data analytics and revenue cycle management teams have the appropriate infrastructure in place to grow our provider base get our providers innetwork with insurance companies and obtain reimbursement for services to enable continued engagement and growth Youll thrive in this role if you are a master communicator and endlessly curious with a love for crossfunctional learning and collaboration as well as datainformed storytelling As you get to know our internal systems and processes better youll have the opportunity to expand your impact into different areas of the business and youll eventually become the goto person for a myriad of responsibilities pertaining to our partners unique needs <p> <ul> <li> <p> Lead key partnership implementation workstreams including new partnership development expansion of existing partnerships and collaboration with internal and external crossfunctional partners Internal teams include Growth Customer amp Client Support Tech and other Insurance Operations teams <p> <li> <li> <p> Lead implementation of new opportunities for partnerships at Grow and act as the subject matter expert on partner KPIs <p> <li> <li> <p> Develop creative strategies to deepen our existing relationships with partners that are of high value to our organization and mission <p> <li> <ul> <p> <em> Salary range $116000 $140000 <em> <p> <p> <strong> Youll Be a Good Fit If <strong> <p> <ul> <li> <p> Empathetic Leader You have a strong track record of building high performing teams cross functionally Can intuit the needs of external partners before theyre even shared Ability to performance manage individual team members when necessary <p> <li> <li> <p> Detail Oriented Youre a meticulous reviewer of your own and others work <p> <li> <li> <p> Problem Solver Youre able to identify business challenges based on metrics and analyses and youre ready to recommend solutions to improve business processes <p> <li> <li> <p> MissionDriven Youre here to change the world and youre always connecting your work back to the importance of the Grow Therapy mission <p> <li> <li> <p> Agile You thrive in a fastpaced unpredictable environment and youre able to pivot as new priorities emerge <p> <li> <li> <p> Team Player Youre collaborative by nature relish in camaraderie and group wins and are looked to by your colleagues as a steadfast partner and source of encouragement <p> <li> <li> <p> Passionate Storyteller Youre good at transforming dashboards and other data insights into a compelling story for our external partners taking into account macro goals of our organization plus those of our partners <p> <li> <li> <p> Master of Project Management Youre a master at juggling multiple initiatives and clear ability to prioritize the most important stuff Highly organized and able to keep projects and priorities on track <p> <li> <ul> <p> <em> If you dont meet every single requirement but are still interested in the job please apply Nobody checks every box and Grow believes the perfect candidate is more than just a resume <em> <p> <p> Note Please upload your resume in PDF format <p><p>
Director - Data & AI
Company: TTEC Digital
Location: USA
Posted Apr 29, 2024
<p class=jobDescription> <p> At TTEC Digital we coach clients to ensure their employees feel valued and fully supported because an amazing customer experience is an employee first process Our vision is the same a place where employees know they can thrive <p> <p> <p> <p> The Analytics Practice relies on Data Science Data Engineering and Marketing Analytic team members to equip our clients with the leading tools and datadriven insights needed to personalize and fuel exceptional experiences CX for their customers <p> <p> <p> <p> As the Director Data amp AI working remotely in the US or in a hybrid capacity in the Boston area you will serve as senior subject matter expert in the data amp analytics space for clients with the aim of crafting customer value maximizing growth or improving the business performance of our clients The Director Data amp AI role is a highly visible and strategic position where you will have the opportunity to develop a compelling vision for bringing actionable AIML solutions to our clients and advancing their digital transformations <p> <p> <p> <p> <p> <p> <strong> What youll be doing <strong> <p> <ul> <li> <p> Serve as senior subject matter expert in the data amp analytics space for clients with the aim of crafting customer value maximizing growth or improving the business performance of our clients <p> <li> <li> <p> Advise and partner with clients to solve their business problems with cloudbased modern data architectures and advanced analytics <p> <li> <li> <p> Develop a compelling vision for bringing actionable AIML solutions to our clients and advancing their digital transformations <p> <li> <li> <p> Develop Data and AI products to advance and enable the key mission outcomes for our clients <p> <li> <li> <p> Work closely with the sales and delivery teams to run presales efforts and engagements <p> <li> <li> <p> Collaborate on business development activities as a domain specialist for the Data and AI team across a variety of clients and industries <p> <li> <li> <p> Drive overall growth of practice through a combination of business development talent management oversight of delivery work and thought leadership <p> <li> <li> <p> Develop proposals presentations statement of work SOW and proactively recommend strategies to grow the data amp analytics practice presence in existing accounts <p> <li> <li> <p> Proactively identify internal and external dependencies issues scope changes and progress against project plan <p> <li> <li> <p> Review select and integrate nextgeneration technologies into the architectural strategy as needed <p> <li> <li> <p> Develop and expand our knowledge base and best practices for delivering data products <p> <li> <li> <p> Perform key leadership and mentorship role in the areas of advanced data techniques including data architecture data integration data governance ML and implementation in cloudbased and hybrid architectures <p> <li> <li> <p> Build and lead highperforming agile teams <p> <li> <li> <p> Devise talent strategy for the team identify resource gaps or inefficiencies build hiring plan recommend promotions and manage performance for consistency with the needs and vision of the department <p> <li> <ul> <p> <p> <p> <strong> What youll bring to us <strong> <p> <ul> <li> <p> Bachelors in Computer Science Engineering or other quantitative field with significant leadership experience <p> <li> <li> <p> 15+ years of demonstrated experience within data amp analytics <p> <li> <li> <p> 5+ years of experience in the consulting industry including technical presales expertise <p> <li> <li> <p> Experience in partner selling pipeline development GoToMarket strategies and management skills with attention to detail <p> <li> <li> <p> Experience leading teams of data engineers data scientists and data storytellers on largescale data projects <p> <li> <li> <p> Experience working on public cloud environments Azure GCP AWS and associated deep understanding of Data and ML tools offered <p> <li> <li> <p> Strong fundaments in data structures algorithms automated testing objectoriented programming performance complexity and implications of architecture on software performance <p> <li> <li> <p> A proven track record of using quantitative analysis to impact key business or product decisions <p> <li> <li> <p> A solid grasp of common statistical applications and methods AB tests and multivariate experiments probabilities regression <p> <li> <li> <p> Understanding of Agile Software Development Lifecycle and project planningexecution skills <p> <li> <li> <p> Desire to thrive in a constantly innovating and changing environment <p> <li> <li> <p> Strong skills in team leadership and networking ability to work across multiple organizations to accomplish diverse goals <p> <li> <li> <p> Exceptional presentation written and verbal communication skills <p> <li> <li> <p> Proven ability to understand the longterm big picture and shortterm perspective of situations <p> <li> <ul> <p> <p> <p> <p> <p> The anticipated range for individuals expressing interest in this position is $ 150K to $200K USD Actual compensation offers to a candidate may vary based on geographic location work experience education andor skill levels This position is eligible to participate in an annual incentive program <p> <p> <p> <p> <strong> Benefits available to eligible employees include <strong> <p> <p> Medical dental and vision <p> <p> Taxadvantaged healthcare accounts <p> <p> Financial and income protection benefits <p> <p> Paid time off PTO and wellness time off <p> <p> <p> <p> LIMS1 <p> <p> <p> <p> <strong> About Us <strong> <p> <p> TTEC Digital and our 1800+ employees pioneer engagement and growth solutions that fuel the exceptional customer experience CX Our sister company TTEC Engage is a 60000+ employee service company with customer service representatives located around the world TTEC Holdings Inc is the parent company for both Digital and Engage When clients have a holistic need they can draw from these independently managed centers of excellence TTEC Digital and TTEC Engage <p> <p> <p> <p> We are also delighted to share that TTEC has been awarded the Great Place To Work 20242025 certification based on outstanding employee experience across 14 countries <p> <p> <p> <p> TTEC is a proud equal opportunity employer where all qualified applicants will receive consideration for employment without regard to age race color religion sex sexual orientation gender identity national origin disability TTEC has fully embraced and is committed to expanding our diverse and inclusive workforce We strive to reflect the communities we serve while delivering amazing service and technology centered around humanity <p> <p> <p> <p> Rarely do applicants meet all desired job qualifications so if you feel you would succeed in the role above please take a moment and share your qualifications <p> <p> <p> <p> <p> <p> LIRemoteUS <p><p>