Holidays Jobs in USA

144,841 open positions · Updated daily

Looking for Holidays jobs in USA? Browse our curated listings with transparent salary information to find the perfect Holidays position in the USA area.

Senior Product Manager

Company: Oddball

Location: USA

Posted Apr 29, 2024

Oddball believes that we can bring change and improve the daily lives of millions by bringing quality software to the federal space Our team is full of experienced engineering product and user experience professionals who love bringing scalable solutions to life as much as they love working with clients to solve problems We value learning growth and the ability to make a big impact at a rapidly growing company Product Managers at Oddball are advocates motivators and some of the companys most important decisionmakers To effectively serve in these roles our product team exhibits strong domain knowledge leadership communication intellectual aptitude strategic visioning and analytical decisionmaking skills Each of these are critical to ultimately lead their teams in designing developing and shipping great products We are looking for an experienced datadriven deliveryfocused Senior Product Manager to help lead our engineering efforts as we grow and deliver for our clients What youll be doing The ideal candidate will be working collaboratively with management engineering and operations teams to oversee the design creation and seamless delivery of various products for our federal clients This deliveryfocused Product role will focus primarily on ensuring their products solve the clients big problems What youll bring <ul> <li> 4+ years full product lifecycle experience working with quickly growing technically focused companies <li> <li> Experience leading and managing crossfunctional agile teams that deliver userfacing products <li> <li> Understanding of multiple disciplines such as Product Management Engineering Design Sales etc <li> <li> A proven ability to solve problems and drive solutions with development teams through data analysis market requirements product specifications and federal requirements <li> <li> An eye for quality organization and clear communication with teams and clients <li> <li> Federal work experience is preferred <li> <li> Strong data analysis experience is required Basic SQL or other database knowledge is preferred <li> <ul> Requirements <ul> <li> Must be a US Citizen and able to work domestically <li> <li> Must be able to attain lowlevel security clearance <li> <ul> Education <ul> <li> Bachelors Degree <li> <ul> Benefits <ul> <li> Fully remote <li> <li> Tech amp Education Stipend <li> <li> Comprehensive Benefits Package <li> <li> Company Match 401k plan <li> <li> Flexible PTO Paid Holidays <li> <ul> Oddball is an Equal Opportunity Employer and does not discriminate against applicants based on race religion color disability medical condition legally protected genetic information national origin gender sexual orientation marital status gender identity or expression sex including pregnancy childbirth or related medical conditions age veteran status or other legally protected characteristics Any applicant with a mental or physical disability who requires an accommodation during the application process should contact an Oddball HR representative to request such an accommodation by emailing <a class=fontbold underline fontbold underline fontbold underline href=mailtohelloOddballio rel=noopener noreferrer nofollow target=blank> helloOddballio <a> Compensation At Oddball its important each employee is compensated competitively and fairly In alignment with state legal requirements A range for the included position is listed below Be advised actual offer details are determined by job category job location and candidate skill level United States Wage Range $100000 $140000

View Details Apply on workingnomads

Director - Corporate FP&A

Company: Icertis

Location: USA

Posted Apr 30, 2024

With unmatched technology and categorydefining innovation Icertis pushes the boundaries of whats possible with contract lifecycle management CLM The AIpowered analystvalidated Icertis Contract Intelligence ICI platform turns contracts from static documents into strategic advantage by structuring and connecting the critical contract information that defines how an organization runs Today the worlds most iconic brands and disruptive innovators trust Icertis to fully realize the intent of their combined 10 million contracts worth more than $1 trillion in 40+ languages and 93 countries Who we are Icertis is the only contract intelligence platform companies trust to keep them out in front now and in the future Our unwavering commitment to contract intelligence is grounded in our FORTE valuesFairness Openness Respect Teamwork and Executionwhich guide all our interactions with employees customers partners and stakeholders Because in our mission to be the contract intelligence platform of the world we believe how we get there is as important as the destination As the Director of FPampA you will play a critical leadership role you will work closely with all of companys functional leaders and bring key market strategic and operational insights that will shape the direction of the company and accelerate its growth You will also play a key role in telling the companys financial story to investors The ideal candidate will have a proven trackrecord of driving business outcomes through keen financial insight and business modeling They will have the ability to create a 360degree financial picture of the business that reflects and influences the companys strategy and be excellent at communicating with senior leaders and executives They will be toolsavvy with experience in creating scalable data and reporting solutions that support a datadriven culture LIRS1 What you will do <ul> <li> Formulate a robust 360degree financial picture of the business complete with market insights and operational drivers <li> <li> Develop and maintain the 3year Strategic Planning Model and forecast <li> <li> Deliver Global PampL and cash flow forecasts <li> <li> Drive Annual Planning Process work cross functionally to build and maintain the Annual Financial Plan and Departmental Budgets <li> <li> Build and deliver Business Performance ReportingOperating dashboards <li> <li> Perform strategic business analysis as needed MampA Geo Expansion <li> <li> Prepare financial analyses as needed to help drive improvements in the business Current focus areas include market expansion opportunities competitive benchmarking analyses pricing and strategic financial optimization strategies <li> <li> Partner with Controller to enhance and accelerate the financial reporting process <li> <li> Identifies and implements system and process improvements to increase the efficiency and effectiveness of planning and reporting workflows <li> <li> Prepare communications to Board of Directors <li> <li> Drive investor presentations and supporting analysis <li> <li> Develop a deep understanding of the business metrics with an eye towards understanding the benefits and risks from a financial perspective and helping to manage key business drivers and desired outcomes <li> <li> Play a key role in preparation of critical public financial documents to support the IPO process including working with bankers and supporting the production of investor materials and SEC filings eg S1 <li> <ul> What you will bring <ul> <li> 12+ years of experience of working in direct strategic analysis support of all aspects of the business at all areas of the PampL <li> <li> MBACPA or equivalent experience preferred <li> <li> Demonstrated complex modeling experience this is a handson role and managers are expected to directly contribute and lead by example <li> <li> Highly analytical detailoriented with a commitment to creating a highquality product Naturally inquisitive and able to extract information from various sources to identify and understand the underlying issue Not afraid to question results <li> <li> Prior success working in a fastpaced entrepreneurial environment takes initiative and works independently <li> <li> Working knowledge of accounting principles required including revenue recognition amortization and accrual vs cash accounting Must have a general understanding of financial statements <li> <li> Must have exceptional written visual and spoken communication skills <li> <li> Experience in preparing and delivering executive board and investor level communications <li> <li> IPO experience is a plus <li> <li> Must have advanced Excel Netsuite and Powerpoint skills <li> <li> Experience implementing financial analysis and planning tools required <li> <ul> $146000 $219000 a year Pay offered will vary based on jobrelated factors such as location experience training skills and abilities In addition to the base salary and annual bonus target and an equity component is included in the compensation package What we offer We are committed to the health and wellbeing of all Icertians their families the communities they live in and our customers This commitment is represented in the Icertis Four Rings of Responsibility Take Care of Self Take Care of Family Take Care of Community and Take Care of Business in that order To support these commitments Icertis offers excellent health and welfare benefits a generous 401k match and a robust paid time off program Here are some of the other reasons <a class=fontbold underline fontbold underline postingslink href=httpswwwicertiscomcompanynewsicertisplacesfirstinwashingtons100bestcompaniestoworkfor rel=noopener noreferrer nofollow target=blank> Icertis Places First in Washingtons 100 Best Companies to Work For | Icertis <a> ● Equity RSUs and shared ownership in the company ● Flexible work environment ● Paid maternity and paternity leave ● 7 Days for Humanity 7 paid volunteer days ● Generous holidays including the 4th of July week off paid ● Free professional and leadership coaching ● Annual personal development allowance Icertis Inc provides Equal Employment Opportunity to all employees and applicants for employment without regard to race color religion gender identity or expression sex sexual orientation national origin age disability genetic information marital status amnesty or status as a covered veteran in accordance with applicable federal state and local laws Icertis Inc complies with applicable state and local laws governing nondiscrimination in employment in every location in which the company has facilities If you are in need of accommodation or special assistance to navigate our website or to complete your application please send an email with your request to <a class=fontbold underline fontbold underline postingslink href=mailtocareersicertiscom rel=noopener noreferrer nofollow target=blank> careersicertiscom <a> or get in touch with your recruiter By submitting your application you acknowledge that you have read Icertiss Privacy Policy <a class=fontbold underline fontbold underline postingslink href=httpswwwicertiscomprivacystatement rel=noopener noreferrer nofollow target=blank> httpswwwicertiscomprivacystatement <a> Icertis is not open to third party solicitation or resumes for our posted FTE positions Resumes received from third party agencies that are unsolicited will be considered complimentary

View Details Apply on workingnomads

Senior Software Engineer

Company: Superhuman

Location: USA

Posted Apr 29, 2024

<h2> SUPERHUMAN 👉 <h2> <ul> <li> The fastest email experience in the world <li> <li> Loved and adored <a class=fontbold underline fontbold underline fontbold underline href=httpssuperhumancomlove rel=noopener noreferrer nofollow target=blank> see what our customers say <a> <li> <ul> Our customers get through their inboxes twice as fast many see inbox zero for the first time in years Come shape the future of email communication and productivity <h2> BUILD LOVE 💜 <h2> At Superhuman we deeply understand <a class=fontbold underline fontbold underline fontbold underline href=httpsblogsuperhumancomgamedesignnotgamification rel=noopener noreferrer nofollow target=blank> how to build products that people love <a> We incorporate fun and play we infuse magic and joy we make experiences that amaze and delight It all starts with the right team a team that deeply cares about values customers and each other <h2> CREATE MASSIVE IMPACT 🚀 <h2> Were not solving a small problem and were not addressing a small market Were going after email the one activity that consumes more of our work day than any other Our ambition doesnt stop there Next calendars notes contacts and tasks We are building the productivity platform of the future <h2> DO THE BEST WORK OF YOUR LIFE 🌟 <h2> We have created the frameworks for how to build product market fit and redefined the narrative of how to onboard customers successfully We have shown the world its possible to build a premium productivity brand Our investors include Andreessen Horowitz First Round Capital IVP Tiger Global Management Sam Altman and the founders of Gmail Dropbox Reddit Discord Stripe GitHub AngelList and Intercom Our latest financing was led by IVP and we welcomed Ajay Vashee to our board Our prior financing was led by Andreessen Horowitz and we welcomed Marc Andreessen and David Ulevitch to our board This time were swinging beyond the fences and <a class=fontbold underline fontbold underline fontbold underline href=httpswwwivpcomnewsblogsuperhumanreimaginingworkplacecommunication rel=noopener noreferrer nofollow target=blank> fundamentally rethinking how individuals and teams should collaborate <a> We are building a household brand and a worldwide organization We are here to do the best work of our lives and we hope you are too <h2> ROLE 👩🏽‍💻👨‍💻 <h2> <ul> <li> Successfully implement Calendar features that enhance user experience and drive user engagement <li> <li> Contribute to the product development process thinking through UX designing beautiful UI and working with customers to solve their problems <li> <li> Help estimate plan and complete projects features and integrations <li> <li> Champion code quality new technologies and architectural design within the company <li> <li> Technologies we use React Golang Postgres Electron Google Cloud <li> <ul> <h2> SOUND LIKE YOU 🙌 <h2> <ul> <li> Experience You have 5+ years of software engineering experience <li> <li> Technical Skills Youre an expert in frontend technologies such as Javascript or Typescript You have a strong foundation in software engineering principles that prioritize highquality maintainable code that adheres to best practices Youre able to identify problems propose solutions and make informed decisions to drive forward our technical efforts Youre comfortable dealing with ambiguity and can think critically to make decisions that benefit the company and our users <li> <li> Remarkable Quality You produce work that is striking worthy of attention and a contribution to the state of the art <li> <li> Asynchronous Communicator Youre effective across various mediums especially Slack Notion and email and can produce and consume detailed written materials as needed without sacrificing speed You respond quickly and thoughtfully to unblock others and speed things up <li> <li> StarttoFinish Ownership You act with 100 responsibility for your own outcomes as well as the outcomes of the company You discuss and debates ideas openly You focus on the customer and business so what and challenge stakeholders to take impactful action <li> <li> Bias to action Speed matters You take rapid and decisive steps forward even in the face of uncertainty and recognize that action is the catalyst for progress and growth <li> <li> Location Were open to you joining us in our San Francisco office or from a home office anywhere in North or South America <li> <ul> <h2> SALARY INFO 💸 <h2> The Software Engineer Calendar role spans several internal levels and a wide breadth of experience at Superhuman Our compensation band reflects the potentially broad range of candidates and experience levels that we are open to hiring for this role Our starting salaries for this role range from $165000 $185000 The salary range does not reflect total compensation which includes base salary benefits and company stock options We are open to candidates in the US Canada or Latin America We take a locally informed approach to nonUSbased compensation and will be able to share ranges based on your country of residence <h2> BENEFITS 🎁 <h2> Taking Care of Your Future 🙏 <ul> <li> Medical dental and vision insurance 100 coverage for you and 75 coverage for all your dependents <li> <li> Voluntary insurance shortterm disability longterm disability and life insurance <li> <li> 401k plan we match 75 cents per dollar up to 4 of your salary <li> <li> Free access to Northstar a financial wellness platform that provides financial advisors + personal finance tools <li> <ul> Generous Time Off 🏝 <ul> <li> Enjoy our generous and flexible Paid Time Off PTO policy with our amazing team members taking an average of 20 days per year <li> <li> 13 additional company holidays plus your own Care Days Flexible Holidays and a companywide Winter Break <li> <li> Generous parental caregiver healthcare and compassionate leave policies <li> <ul> Investing in Your Growth ✍️ <ul> <li> $3000 per year towards your professional development <li> <li> Free access to Calm and Taskhuman <li> <li> Allyship education program to help build your best self <li> <ul> Setting You Up For Success 🧑🏻‍💻👩🏾‍💻 <ul> <li> Custom MacBook Pro <li> <li> $1000 budget for workstation setup <li> <li> $260month for your lunches groceries or whatever nutrition you need to stay fueled up <li> <li> Flexible spending accounts for commuter costs dependent care and healthcare expenses <li> <ul> At Superhuman we value diversity We are an equal opportunity employer we do not discriminate on the basis of race religion color national origin gender sexual orientation age marital status veteran status or disability status

View Details Apply on workingnomads

Manager - Customer Success

Company: Flock Safety

Location: USA

Posted Apr 29, 2024

<h2> Who is Flock <h2> Flock Safety is an allinone technology solution to eliminate crime and keep communities safe Our intelligent platform combines the power of communities at scale including cities businesses schools and law enforcement agencies to shape a safer future together Our fullservice maintenancefree technology solution is trusted by communities across the country to help solve and deter crime in the pursuit of safer communities for everyone Our holistic public safety platform is comprehensive and intelligent providing the actionable evidence needed to solve deter and reduce crime across neighborhoods schools businesses and entire cities Without compromising transparency or privacy we are turning unbiased data into objective answers Flock strives to offer a careerdefining experience where you can also make an impact on your community While safety is a serious business we are a supportive team that is optimizing the remote experience to create strong and fulfilling relationships even when we are physically apart Our group of hardworking employees thrive in a positive and inclusive environment where a bias towards action is rewarded We have raised over $380M in venture capital from investors including Tiger Global Andreessen Horowitz Matrix Partners Meritech Capital Partners and Initialized Capital Now surpassing a $3B valuation Flock is scaling intentionally and seeking the best and brightest to help us meet our goal of reducing crime in the United States by 25 in the next three years The Opportunity Flock Safety is looking for a Manager of Customer Success to lead and coach a team of CSMs to deliver value and an exceptional experience to our law enforcement customers This is a fully remote position with expectations that this individual will travel on site to customers and their team as necessary This role will require exemplary leadership skills the ability to manage multiple projects at once critical thinking starttofinish ownership a passion for building strong relationships a desire to coach CSMs and effective communication throughout every interaction The Skillset <ul> <li> 3+ years experience leading customer facing teams preferably customer success in a SaaS environment <li> <li> Proven ability to build and manage relationships internally and externally preferably in a SaaS environment <li> <li> Comfortable with deescalation management and navigating tough conversations with a solutionsoriented mindset <li> <li> Highly adaptable individual who embraces change and knows how to pivot when confronted with new challenges <li> <li> Can deliver honest and productive feedback to individuals on their team <li> <li> Communicates clearly and concisely about both technical and nontechnical subject matter <li> <li> Diplomatic tactful and poised under pressure with a high comfort with ambiguity <li> <li> Demonstrate strong followthrough and ability to selfmanage multiple tasks and projects at once <li> <li> Passionate about Customer Success the people the relationships and the interactions that drive mutually beneficial results <li> <li> Team player that contributes positively to overall team morale and company culture <li> <li> Willingness to travel <li> <li> Experience using Gainsight or another CS platform preferred <li> <ul> Feeling uneasy that you havent ticked every box Thats okay weve felt that way too Studies have shown women and minorities are less likely to apply unless they meet all qualifications We encourage you to break the status quo and apply to roles that would make you excited to come to work every day 90 Days at Flock We are a resultsoriented culture and believe job descriptions are a thing of the past We prescribe to 90 day plans and believe that good days lead to good weeks which lead to good months This serves as a preview of the 90 day plan you will receive if you were to be hired as a Manager Customer Success at Flock Safety The First 30 Days <ul> <li> Get to know the product <li> <li> Build relationships and trust with your team 812 CSM <li> <li> Attend CSM Calls dive into Gainsight review OKRs and meet with all direct reports <li> <li> Deepen your understanding of the sales process and our customers by listening to call recordings across the buyers journey in each segment <li> <li> By the end of the 30 days start a meeting operating rhythm with your team and crossfunctional partners 11s team meetings other <li> <ul> The First 60 Days <ul> <li> Continue getting to know the customer <li> <li> Create a coaching frame work <li> <li> Establish a project plan <li> <li> Start work tracking in order to help your team achieve their goals <li> <ul> 90 Days amp Beyond <ul> <li> Coach the team to drive Net Revenue Retention through proactive and strategic engagementexpansion efforts <li> <li> Ensure communication and collaboration with leaders across the business to achieve the most value possible for our customers <li> <li> Create processes and systems to drive raving promoters we have a product that our customers truly love its your opportunity to ensure our largest customers are seeing value from it <li> <ul> The Interview Process We want our interview process to be a true reflection of our culture transparent and collaborative Throughout the interview process your recruiter will guide you through the next steps and ensure you feel prepared every step of the way <ul> <li> Our First Chat During this first conversation youll meet with a recruiter to chat through your background what you could bring to Flock what you are looking for in your next role and who we are <li> <li> The Hiring Manager Interview You will meet with your potential future boss to really dive into the role the team expectations and what success means at Flock This is your chance to really nerd out with someone in your field <li> <li> The Panel Learn more about the team responsibilities and workflows You should be prepared to speak about past projects how you collaborate and communicate with others and how you live our values Depending on the team and role you are interviewing for you may meet with several teammates as well as crossfunctional partners <li> <li> The Technical Assessment Our technical assessments seek to test the hard skills required to do the job Engineers may find themselves in coding interviews or architecture discussions sales roles may present mock discovery calls and leadership roles may craft 90 day plans Your recruiter will inform you of which assessment you will be assigned and ensure you are fully prepared for your big day <li> <li> The Executive Review A chance to meet an executive and view Flock from a different lens Be prepared to ask wellthoughtout questions about the company culture and more <li> <ul> The Perks 💰Salary amp Equity In this role youll receive a starting salary of $11500000$145000K as well as stock options 🌴 Use what you need PTO We seriously mean it plus 11 company holidays and your birthday off ⚕️ Fullypaid <a class=fontbold underline fontbold underline fontbold underline href=httpsdrivegooglecomfiled1W8ofLMVCOWL9pYFAVSMsSTaJAA9VmJview rel=noopener noreferrer nofollow target=blank> health benefits <a> plan for employees including Medical Dental and Vision and an HSA match 👪 Family Leave All employees receive 12 weeks of 100 paid parental leave Birthing parents are eligible for an additional 68 weeks of physical recovery time 🍼 Fertility amp Family Benefits We have partnered with <a class=fontbold underline fontbold underline fontbold underline href=httpswwwmavencliniccom rel=noopener noreferrer nofollow target=blank> Maven <a> a complete digital health benefit for starting and raising a family We will reimburse $10000 a year for adoption surrogacy or fertility 🧠 Mental Health All employees receive an annual subscription to <a class=fontbold underline fontbold underline fontbold underline href=httpswwwheadspacecom rel=noopener noreferrer nofollow target=blank> Headspace <a> 💖 Caregiver Support We have partnered with <a class=fontbold underline fontbold underline fontbold underline href=httpswwwcariloopcom rel=noopener noreferrer nofollow target=blank> Cariloop <a> to provide our employees with caregiver support 💸 Carta Tax Advisor Employees receive 11 sessions with Equity Tax Advisors who can address individual grants model tax scenarios and answer general questions 💻WFH Stipend $150 per month to cover the costs of working from home 📚Productivity Stipend $250 per year to use on Audible Calm Masterclass Duolingo Grammarly and so much more 🏠Home Office Stipend A onetime $750 to help you create your dream office 🏢Coworking Space If youre not local to our ATL HQ well provide $250 a month to get you set up with an All Access Membership to WeWork or a local coworking space in your area 🐾 Pet Insurance Weve partnered with <a class=fontbold underline fontbold underline fontbold underline href=httpshellopumpkincarecomparesemutmsource=googleamputmmedium=cpcamputmcampaign=GoogleUSASearchBrandamputmcontent=GoogleUSASearchBrandGeneralExactamputmcampaignid=15710600630amputmadgroupid=131181652986amputmadid=571944109837amputmkeyword=pumpkin20pet20insuranceamputmmatchtype=eampgclid=Cj0KCQiA1sucBhDgARIsAFoytUuUlyKvQJvyvkLRt5ii432apq7ng3BLv0vyiWHFdaawRznFrsMckaAvI5EALwwcB rel=noopener noreferrer nofollow target=blank> Pumpkin <a> to provide insurance for our employees fur babies Flock is an equal opportunity employer We celebrate diverse backgrounds and thoughts and welcome everyone to apply for employment with us We are committed to fostering an environment that is inclusive transparent and collaborative Mutual respect is central to how Flock operates and we believe the best solutions come from diverse perspectives experiences and skills We embrace our differences and know that we are stronger working together If you need assistance or an accommodation due to a disability please email us at careersflocksafetycom This information will be treated as confidential and used only to determine an appropriate accommodation for the interview process

View Details Apply on workingnomads

Deputy Director, - Campaigns

Company: CALSTART

Location: USA

Posted Apr 29, 2024

About Us For over 30 years its been CALSTARTs mission to develop assess and implement largescale zeroemission transportation solutions to mitigate climate change and support economic growth CALSTART works with businesses organizations governments and communities to create reallife impact toward clean air and equitable access to clean transportation for all CALSTART provides scientific technical and policy support for regulatory development and clean technology and infrastructure acceleration About The Role Are you a creative thinker with a passion for communication and great prose Are you excited about decarbonizing the transportation industry globally through crafting educational content social media strategies virtual events with countries all over the world CALSTARTs Drive to Zero team is looking for a dynamic marketing manager passionate about zero emissions to develop and execute marketing campaigns In this role you will be responsible for overall campaign strategy execution evaluation and optimization globally You will be responsible for driving digital and content strategy through media paid resources email webinars and events The ideal candidate will have experience of managing multiple highprofile projects simultaneously in partnership with crossfunctional teams developing messaging storytelling while streamlining processes They will possess a successful track record of executing multichannel campaigns that expand awareness acquire and convert new signatories and drive demand Content strategy will be your passion What Youll Do <ul> <li> Create and execute the marketing strategy for CALSTARTs global Drive To Zero program which includes but not limited to social email paid media events webinars <li> <li> Responsible for the successful execution of 4 virtual events per year <li> <li> Build graphics flyers short videos to help promote new country signatories to join the global MOU <li> <li> Support adhoc marketing requests as needed <li> <li> Support marketing campaigns for Truck and OffRoad initiative <li> <ul> What Youll Bring To The Table <ul> <li> 6+ years of professional marketing experience <li> <li> 6+ years of program related work <li> <li> Experience with data analytics <li> <li> Experience creating executing and scaling marketing campaigns from concept to completion across multiple media platforms and strategies <li> <li> Loves teamwork and rolling up their sleeves to get the job done <li> <li> Excellent interpersonal and communication skills <li> <li> Bachelor degree <li> <ul> Desired Qualifications <ul> <li> Masters degree <li> <li> Experience developing and executing campaigns across a many time zones and languages <li> <li> Experience with customer segmentation profiling and targeting <li> <li> Mailchimp andor Salesforce experience an added bonus <li> <li> The ability to make things happen quickly <li> <ul> $105630 $120260 a year CALSTART values transparency and strives to provide as much information regarding compensation as possible The complete salary range for this role is $105630 $120260 Pay for this role will typically be from $105630 $112945 as we determine pay based on several factors including but not limited to jobrelated skills qualifications experience education internal equity and other factors relevant to the job We understand that not everyone will match the above qualifications 100 If your background isnt perfectly aligned but you feel you would be a great addition to the team wed love to hear from you Were a tightknit team of worldclass innovators business minds and change agents who believe passionately in our mission and put our team ahead of self We are committed to the continued development and growth of our employees and invest in your success We care about your personal well being as much as your professional success and offer generous benefits to full time employees including 100 company paid comprehensive health benefits for Medical Dental Vision Short Term Disability Long Term Disability and Life Insurance Retirement plan with generous company contributions FSA for Health and Dependent Care 3 weeks of vacation time in the first year of employment 11 paid company holidays paid sick time paid family leave and more Our inclusive environment focuses on making decisions based on merit without regard to race color hair texture gender religion age nationality social or ethnic origin sexual orientation gender identity gender expression LGBTQIA+ status marital status pregnancy disability genetics veteran status or any other characteristic protected by law

View Details Apply on workingnomads

Enterprise Growth Account Executive consultative sales approach driving sales growth

Enterprise Account Manager

Company: Pagerduty

Location: USA

Posted Apr 29, 2024

PagerDuty is seeking an Enterprise Growth Account Executive with experience selling SaaS products to Enterprise accounts. The role involves leading and managing a pipeline of opportunities within existing accounts to deliver results against sales targets. The ideal candidate should have a consultative sales approach, a proven knack for driving sales growth, and the ability to captivate a tech-savvy audience. Key responsibilities include value selling, sales effectiveness, and sales execution. The base salary range for this position is 130,000 - 140,000 USD. PagerDuty offers a comprehensive total rewards approach, including competitive salary, comprehensive benefits, flexible work arrangements, and more.

View Details Apply on Remoteio

Software Engineer - Seller Experience

Company: Whatnot

Location: USA

Posted Apr 30, 2024

<h2> 🚀 Whatnot <h2> Whatnot is a livestream shopping platform and marketplace backed by Andreessen Horowitz Y Combinator and CapitalG Were building the future of ecommerce bringing together community shopping and entertainment We are committed to our <a class=fontbold underline fontbold underline fontbold underline href=httpswwwwhatnotcomcareers rel=noopener noreferrer nofollow target=blank> values <a> and as a remotefirst team we operate out of hubs within the US Canada UK Ireland and Germany today Were innovating in the fastpaced world of live auctions in categories including sports fashion video games and streetwear The platform couples rigorous seller vetting with a focus on community to create a welcoming space for buyers and sellers to share their passions with others And were growing Whatnot has been the <a class=fontbold underline fontbold underline fontbold underline href=httpsa16zcommarketplace100 rel=noopener noreferrer nofollow target=blank> fastest growing marketplace <a> in the US over the past two years and were hiring forwardthinking problem solvers across all functional areas <h2> 💻 Role <h2> The Seller Experience team plays a crucial role in empowering our community of sellers with tools and experiences that allow them to succeed and grow on Whatnot You will be at the forefront of developing scalable user friendly solutions that enhance the seller journey at every step of the lifecycle from onboarding scaling and growth The problems you will tackle span from Casual Resellers to Large Retailers <h2> 👋 You <h2> Curious about who thrives at Whatnot Weve found that low ego a growth mindset and leaning into action and high impact goes a long way here As our next Software Engineer you should have 5+ years of generalist software engineering experience at a fast growing technology company plus <ul> <li> We primarily use Python JavaScript Elixir and are open to others <li> <li> Excellent product instincts You first think about users rather than the best technical solution <li> <li> You are known for shipping products and features lightningfast <li> <li> Youre an excellent problem solver and dont need to be told exactly what to do <li> <li> Comfortable working across the stack backend and frontend <li> <li> Ability to pick up on new technologies very quickly <li> <li> Proven track record of delivering features <li> <li> Bonus Experience building technology in ecommerce contributing to seller experiences and success <li> <ul> <h2> 💰Compensation <h2> For USbased applicants $178000year to $235000year + benefits + stock options The salary range may be inclusive of several levels that would be applicable to the position Final salary will be based on a number of factors including level relevant prior experience skills and expertise This range is only inclusive of base salary not benefits more details below or equity in the form of stock options <h2> 🎁 Benefits <h2> <ul> <li> Flexible Time off Policy and Companywide Holidays including a spring and winter break <li> <li> Health Insurance options including Medical Dental Vision <li> <li> Work From Home Support <ul> <li> $1000 home office setup allowance <li> <li> $150 monthly allowance for cell phone and internet <li> <ul> <li> <li> Care benefits <ul> <li> $450 monthly allowance on food <li> <li> $500 monthly allowance for wellness <li> <li> $5000 annual allowance towards Childcare <li> <li> $20000 lifetime benefit for family planning such as adoption or fertility expenses <li> <ul> <li> <li> Retirement 401k offering for Traditional and Roth accounts in the US employer match up to 4 of base salary and Pension plans internationally <li> <li> Parental Leave <ul> <li> 16 weeks of paid parental leave + one month gradual return to work company leave allowances run concurrently with country leave requirements which take precedence <li> <ul> <li> <ul> <h2> 💛 EOE <h2> Whatnot is proud to be an Equal Opportunity Employer We value diversity and we do not discriminate on the basis of race religion color national origin gender sexual orientation age marital status veteran status parental status disability status or any other status protected by local law We believe that our work is better and our company culture is improved when we encourage support and respect the different skills and experiences represented within our workforce

View Details Apply on workingnomads

Program Director - States Portfolio

Company: Nava

Location: USA

Posted Apr 29, 2024

About Nava Nava is a consultancy and public benefit corporation working to make government services simple effective and accessible to all Since 2013 federal state and local government agencies have trusted Nava to build transformative digital services to help people access public benefits Meeting our mission is an opportunity to restore trust between people and public institutions We focus on populations that are the least protected because the stakes are higher As a client services company we work with government agencies to improve how people apply for benefits navigate their health care and more We bill for our time selling our expertise and problemsolving methodology to government clients Our clients hire us to help improve their products and services so that their users and beneficiaries have a better customer experience These endusersthe humans who benefit from our workare at the core of everything we do We research beneficiaries needs to help our government clients better deliver on their missions providing everyone at Nava opportunities to do meaningful impactful work Position Summary Nava is at the forefront of reimagining how our government serves its people and were looking for a Program Director to lead the delivery and client engagement efforts on a portfolio of strategic contracts At Nava members of the Program leadership team are responsible for client trust and relationships team clarity and health staffing contract management profit amp loss and organic growth Details are in the What Youll Do section below Navas Program Directors oversee delivery outcomes and client relationships directing large 50people+ teams to create positive delivery environments Opportunities and Challenges Nava provides opportunities to do meaningful impactful missionoriented work As a public benefit corporation we have a social mission written into our founding charter The people who work at Nava have a fiduciary duty to our stated mission to improve access effectiveness and simplicity of government services We see this as an opportunity but it is also important to highlight the challenges we face in advance You will be working within the government ecosystem which means working dynamically with other government contractors and civil servants Working with people outside of your company means youll likely encounter different working styles cultural norms and be responsible for maintaining order and focus without authority At the same time working as part of a larger team allows us to deliver on projects of larger scale and complexity The government contracting ecosystem is a compliancedriven multistakeholder environment particularly when compared to the operating environments of companies of our size in the private sector Successful members of our team understand how to be innovative within this environment when responding to proposals or delivering software and infrastructure Finding and recommending ways to improve the way government digital services are procured and built is one of the highestleverage ways we help fulfill our mission What Youll Do <ul> <li> Client trust and relationships <li> <li> Exceed the expectations of our government partners by cultivating strong trusting relationships and maintaining high situational awareness at the agency level <li> <li> Proactively detect risks and work collaboratively with the delivery team and program stakeholders to effectively resolve them issues can span delivery process culture expectation setting staffing contract milestones finances <li> <li> Engage our clients on a continuing basis to ensure their needs are met or exceeded understand their vision collaboratively solve issues and communicate our progress transparently <li> <ul> <ul> <li> Organicadjacent growth and recompetes <li> <li> Instigate growth at scale for example by expanding into neighboring programs or modifying an existing contract with new work <li> <li> Maintain awareness of the broader landscape and potential for new opportunities and risks <li> <ul> <ul> <li> Team clarity and health <li> <li> Collaborate across projects and across the organization to proactively anticipate and solve problems across delivery <li> <li> Support the creation of delivery environments built on mutual trust between government partners and our team <li> <ul> <ul> <li> Team composition <li> <li> Scale efforts through a team of project managers and other functional delivery leads <li> <ul> <ul> <li> Contract management profit amp loss <li> <li> Ensure that Nava is delivering contract scope on time within budget act as the budget owner for your program in coordination with the finance team and coordinate necessary contract modifications <li> <ul> <ul> <li> Internal <li> <li> Set and uphold standards for delivery excellence and client service <li> <li> Apply Navas policies and guidance at the program level Eg utilization guidance <li> <li> Participate in developing on and delivering company objectives and key results <li> <ul> Required skills <ul> <li> At least 12 years of experience managing complex software delivery efforts in highly constrained environments including experience overseeing agile software development efforts <li> <li> Bachelors degree or equivalent experience <li> <li> Empathetic communicator and relationship builder with a collaborative and positive mindset able to take a serviceoriented approach to supporting the program team and our clients <li> <li> An extremely adaptable problem solver who can deal with multidimensional challenges involving many organizations processes cultures and technologies <li> <li> You are highly organized and care deeply about building and growing a sustainable cultureconscious business <li> <li> Ability to take a strategic approach to delivery planning and contract management over the mediumterm and longterm <li> <li> An iterative approach to execution that emphasizes rapid team progress <li> <li> Ability to manage contract finances in coordination with the finance team <li> <li> Ability to maintain broader situational awareness beyond the immediate team <li> <li> Excellent written and verbal communication skills <li> <ul> Desired skills <ul> <li> State experience running large portfolios <li> <li> Project management in a government context <li> <li> Track record of introducing and expanding agile transformation and pursuing best practices in project management with clients and stakeholders <li> <li> Experience managing projects that provide production operations and support alongside ongoing productfeature development <li> <li> Experience launching new production systems with high public visibility in a fastchanging regulatory environment <li> <li> Experience with both the use and management of Jira and Confluence <li> <ul> $177000 $220000 a year Other requirements The individual working in this position ● Must be legally authorized to work in the United States and meet any other requirements for government contracts for which they are hired ● Candidates who are offered a job with Nava must possess work authorization that does not require sponsorship by their employer for a visa now or in the future ● May be subject to a government security investigation and must meet eligibility requirements for access to classified information or applicants who are eligible for security clearances Perks working with Nava ● Competitive benefits We prioritize your wellbeing offering highly competitive medical dental and vision benefits ● Generous time off Enjoy 20 days of accrued PTO 12 paid federal holidays 5 floating holidays and unlimited sick leave ● Annual discretionary bonus Paid annually to eligible employees When Nava does well you do well ● Parental leave Receive 16 weeks of fully paid parental leave and weekly meal deliveries during your leave ● Employee wellness program Access our comprehensive Employee Wellness Program ● Virtual doctor visits Enjoy zero copay virtual doctor visits through UHC ● Fertility support Benefit from fertility support and treatment options ● Sabbatical leave We offer a sabbatical leave program ● 401k contributions We match 4 of your salary in 401k contributions ● Flexible work arrangements We offer flexible work arrangements to suit your needs ● Home office setup Receive assistance with your home office setup and a monthly phone allowance ● Utilities reimbursement Get a monthly partial reimbursement for utilities where applicable ● Learning and development Access our comprehensive learning and development program ● Tuition and Professional development budget Receive a prorated annual tuition and professional development budget and a LinkedIn Learning license ● Equity stock options Benefit from equity stock options ● Employee referral program Participate in our employee referral program ● Commuter benefits Enjoy commuter benefits ● Insurance coverage Receive short and longterm disability insurance as well as life and accidental death insurance ● Inclusive culture Join our diverse inclusive highly collaborative and vibrant culture that supports remote work Location You can work in a hybrid work arrangement from one of Navas offices in NYC DC or San Francisco We also have fully remote options if you reside in one of the following states Alabama Arizona California Colorado DC Florida Georgia Illinois Louisiana Maine Maryland Massachusetts Michigan Minnesota Missouri Nevada North Carolina New Jersey New York Oklahoma Oregon Pennsylvania Rhode Island South Carolina Texas Tennessee Virginia Washington Wisconsin If you are not living in one of the states listed above unfortunately you will not be considered for a position at this time Stay in touch Sign up for our <a class=fontbold underline fontbold underline postingslink href=httpsnavapbcus10listmanagecomsubscribeu=c69eb1fd5475fa5122ef55965ampid=a994830182 rel=noopener noreferrer nofollow target=blank> newsletter <a> to find out about career opportunities new partnerships and news from the broader civic tech community Nava PBC equal opportunity employer that is deeply committed to diversity and inclusion in the workplace We prohibit discrimination and harassment of any kind based on race color age gender religious or political beliefs national origin or heritage marital status disability sex sexual orientation or gender identity genetic information pregnancy status as a protected veteran or any characteristic protected by federal state or local laws Our commitment to diversity equity and inclusion not only reflects our values as a public benefit corporation but also enriches our ability to do our work Learn more about where we are today and hope to be by 2025 Please contact the recruiting team at recruitingnavapbccom if you would like to request reasonable accommodation during the application or interviewing process We participate in EVerify Upon hire we will provide the federal government with your Form I9 information to confirm that you are authorized to work in the US This role requires you to work from the contiguous United States

View Details Apply on workingnomads

Product Manager, Claim Reconciliation

Company: Alma

Location: USA

Posted Apr 29, 2024

Product Manager Claim Reconciliation Alma is seeking a missiondriven Product Manager to join our claim reconciliation squad In this role you will be working to scale Almas claim reconciliation platform to build appropriate validations and automations that solve problem claims in the revenue cycle process The ideal person for this role is someone who is detailoriented and can translate business and operational requirements into claim reconciliation rules What youll do <ul> <li> Develop a deep understanding of healthcare revenue cycle domain and Almas claim reconciliation process <li> <li> Outline a roadmap for the claim reconciliation squad prioritized around organizational goals <li> <li> Perform discovery around key problem areas to identify impactful features that will improve the reliability of Almas claims platform <li> <li> Collaborate with crossfunctional teams and stakeholders to identify pain points in operational workflows <li> <li> Define track and analyze key metrics in your domain area along with operational and organizational KPIs aligned to your product space <li> <ul> Who you are <ul> <li> You have 24 years of experience as a Product Manager with proven experience owning a product strategy and roadmap <li> <li> You are a systems thinker with a track record for achieving impactful outcomes <li> <li> You possess a clear and engaging communication style and are able to build positive relationships across a broad diverse organization <li> <li> You are adept at agile methodologies and taking an iterative approach to product lifecycle management <li> <li> You are technically fluent and have familiarity with complex platform integration and workflow automation <li> <li> You value a culture of inclusion and empathy <li> <li> You are passionate about Almas mission to improve the therapy experience for providers and their clients and simplify access to care <li> <ul> Benefits <ul> <li> Were a remotefirst company <li> <li> Health insurance plans through Cigna medical and dental and MetLife vision including FSA and HSA plans 401K plan Roth and traditional <li> <li> Monthly therapy and wellness stipends <li> <li> Monthly coworking space membership stipend <li> <li> Monthly workfromhome stipend <li> <li> Financial wellness benefits through Northstar <li> <li> Pet discount program through United Pet Care <li> <li> Financial perks and rewards through BenefitHub <li> <li> EAP access through Cigna <li> <li> Onetime home office stipend to set up your home office <li> <li> Comprehensive parental leave plans <li> <li> 11 paid holidays 1 Alma Mental Health Day and 1 Alma Volunteering Day <li> <li> Flexible PTO <li> <ul> Salary Band $125000 $145000 Almas compensation philosophy is driven by our company value of building equity To best ensure pay equity we typically bring in new hires near the middle of our listed salary bands and we do not negotiate our compensation ie all people hired at the same level amp role are brought in at the same salary equity and benefits The recruiter you work with can provide more details on our philosophy All Alma jobs are listed on our careers page We do not use outside applications or automated text messaging in our recruiting process We will not ask for any sensitive financial or identification information throughout the recruiting process Any communication during the recruitment process including interview requests or job offers will come directly from a recruiting team member with a helloalmacom email address

View Details Apply on workingnomads

Backend Engineer

Company: Trufflesecurity

Location: USA

Posted Apr 30, 2024

Truffle Security Co is seeking a passionate Software Engineer with experience in Go, gRPC, and K8s to contribute to their core product features. The role involves backend development, gRPC clients and servers, and continuous learning. The company offers a competitive compensation package, flexible paid time off, and a commitment to building a culture of mentorship, equity, and psychological safety. They are looking for individuals who are passionate about open source, security, and building an enjoyable UX.

View Details Apply on Remoteio

Breaking News Reporter

Company: Axios

Location: USA

Posted Apr 29, 2024

Quick Take Axios is a growthstage startup dedicated to providing trustworthy awardwinning news content in an audiencefirst format We are hiring a Breaking News Reporter Why it Matters The Breaking News Reporter role allows earlycareer journalists to put their journalism skills and instincts into practice by writing for our breaking news desk Youll report and aggregate breaking stories that are worthy of our readers time and occasionally report enterprise stories for Axios newsletters The Details The Breaking News Reporter will work closely with our team of editors on a SundayThursday schedule to determine appropriate breaking news stories to feature on Axioscom You will also have the opportunity to collaborate with beat reporters across the Axios newsroom on stories that intersect with our various coverage areas and on items for newsletters Ideal candidates should embody a passion for Axios and Smart Brevity an entrepreneurial spirit and possess the following skills <ul> <li> Exceptional news and editorial judgment and instincts <li> <li> Ability to write clear concise accurate copy <li> <li> Experience aggregating news stories and working in a breaking news environment <li> <li> Outstanding work ethic and comfort in a very fastpaced environment <li> <li> A reader of a wide variety of news and the ability to advance the daily news cycle forward with story pitches <li> <li> Eager to seek feedback and quick to incorporate feedback to grow and strengthen your skills <li> <li> Strong collaboration skills with journalists across all levels <li> <li> A working knowledge of US politics and media as well as an interest in political reporting is encouraged and an asset <li> <ul> What Axios brings to the table besides salary <ul> <li> 401k with employer match <li> <li> Robust PPO and High Deductible health insurance options on the Blue Cross Blue Shield network <li> <li> Employer Health Savings Account HSA contribution for the high deductible health plan option <li> <li> Dental and vision coverage <li> <li> Primary caregiver 12week paid leave <li> <li> Generous vacation policy plus holidays <li> <li> One mental health day per quarter <li> <li> Annual learning and development stipend <li> <li> $100 monthly workfromhome stipend <li> <li> Telemental health services through Headspace <li> <li> OneMedical membership including telehealth services <li> <li> Personal health advocacy resources through HealthAdvocate <li> <li> Inclusive fertility hormonal health and family forming benefits through Carrot Fertility <li> <li> Access to the Axios Family Fund which was created to allow employees to request financial support when facing financial hardship or emergencies <li> <li> Increased work flexibility for parents and caretakers <li> <li> Virtual companysponsored social events <li> <li> A strong and positive work environment <li> <li> A commitment to an open inclusive and diverse work culture <li> <ul> Pay for this role is in the range of $3365hour to $3845hour and is dependent on numerous factors including but not limited to location work experience and skills This range does not include other compensation benefits Please note that this role is a full time hourly nonexempt role that is eligible for overtime pay Equal Opportunity Employer Statement Axios is an equalopportunity employer that is committed to diversity and inclusion in the workplace We prohibit discrimination and harassment of any kind based on race color sex religion sexual orientation age gender identity gender expression veteran status national origin disability genetic information pregnancy or any other protected characteristic as outlined by federal state or local laws This policy applies to all employment practices within our organization including hiring recruiting promotion termination layoff recall leave of absence compensation benefits training and apprenticeship Axios makes hiring decisions based solely on qualifications merit and business needs at the time

View Details Apply on workingnomads

Head of Affiliate Marketing & Referrals

Company: Xero

Location: USA

Posted Apr 29, 2024

Xero is a beautiful easytouse platform that helps small businesses and their accounting and bookkeeping advisors grow and thrive At Xero our purpose is to make life better for people in small business their advisors and communities around the world This purpose sits at the centre of everything we do We support our people to do the best work of their lives so that they can help small businesses succeed through better tools information and connections Because when they succeed they make a difference and when millions of small businesses are making a difference the world is a more beautiful place How youll make an impact As the Head of Affiliate Marketing amp New Channels at Xero you will be responsible for planning implementing and optimizing our affiliate marketing program to maximize revenue and brand exposure You will work closely with other channel teams business development and affiliate partners to develop strategies identify opportunities and manage endtoend affiliate marketing efforts You will also lead the development of new channels like TikTok Reddit Programmatic Display and more You will lead the selection and early development of these channels while ensuring we can thoughtfully deploy more resources as channels prove to scale at attractive ROAS What youll do <ul> <li> Affiliate Strategy Development Develop and execute a comprehensive affiliate marketing strategy aligned with company goals identify target publishers and define target payouts <li> <li> Affiliates and Agency Partners Management Recruit onboard and maintain strong relationships with affiliate partners agencies and networks to expand the affiliate program effectively <li> <li> Content Development Collaborate with affiliate partners on content creation and promotional activities to ensure brand consistency and alignment with company messaging <li> <li> Performance Analytics Regularly analyze and report on affiliate marketing performance using data and analytics tools Use insights to make datadriven decisions and optimize campaigns <li> <li> Tracking and Reporting partner with analytics to build advanced tracking based on predictiveLTV models evolve our revenue share models and measure incrementally <li> <li> New Channels testing identify size and test new channels across multiple markets <li> <li> Team management recruit and grow a team of specialists <li> <ul> What youll bring with you <ul> <li> Critical competencies <li> <li> Deep experience growing global affiliate programs <li> <li> Previous exposure to SaaS partneraffiliate models <li> <li> Experience leading performance marketing teams with a global remit <li> <li> Experience scaling multiple channels <li> <li> Deep understanding of tracking technologies and analytics <li> <ul> <ul> <li> Experience <li> <li> Bachelors degree <li> <li> Extensive experience in growthperformance marketing <li> <li> Previous experience building affiliate programs from the ground up <li> <li> Previous experience scaling channels like TikTok Reddit etc SQL knowledge highly preferred <li> <ul> Why Xero Diversity of people brings diversity of thought and we like that Our humanfirst culture of respect fairness and inclusion is what helps Xeros thrive and work and beyond Offering very generous paid leave to use however youd like plus statutory holidays dedicated paid leave to care for your physical and mental wellbeing as well as an Employee Assistance Program to access mental health care for you and your family employee resource groups wellbeing programming and allowances medical dental vision and disability insurance fertility and family forming financial support 401k contribution matching 26 weeks of paid parental leave for primary caregivers an Employee Share Plan beautiful offices with snacks and break areas flexible working career development and many other benefits that reflect our human value youll do the best work of your life at Xero Research has shown that women and underrepresented groups are less likely to apply to jobs unless they meet every single competency or experience If you are excited about this role but your past experience doesnt align perfectly we encourage you to apply anyway You could be just the right person for this role and Xero If you have any support or access requirements we encourage you to advise us at time of application and throughout the interview process

View Details Apply on workingnomads

Previous
1
...
371
372
373
374
375
...
12071
Next

Frequently Asked Questions

What are the typical salary ranges for Holiday roles by seniority?

Entry‑level Holiday positions start around $30k–$45k annually. Mid‑level roles, such as Inventory Analysts or Marketing Specialists, earn $45k–$70k. Senior positions—Retail Operations Managers or E‑commerce Platforms Administrators—can command $70k–$100k+ depending on experience and region.

What skills and certifications are required for Holiday positions?

Key skills include proficiency in POS and ERP software (e.g., SAP Retail, Oracle Retail), data analytics tools (Tableau, Power BI), and digital marketing platforms (Shopify, Adobe Commerce). Certifications such as Certified Holiday Operations Professional (CHOP), SAP Certified Application Associate – Retail, Salesforce Certified Administrator, and Google Analytics Individual Qualification are highly valued.

Is remote work available in the Holiday category?

Yes. Many Holiday roles, especially in e‑commerce platform administration, marketing strategy, and inventory analytics, support remote or hybrid work setups. Companies provide cloud‑based dashboards, virtual collaboration tools (Slack, Teams), and flexible scheduling to accommodate holiday peak periods.

What career progression paths exist within Holiday roles?

Professionals can advance from junior analyst or associate roles to senior analyst, then to managerial positions such as Operations Manager or Marketing Director. Additional growth opportunities include moving into cross‑functional strategy, data science for demand forecasting, or leading multinational holiday‑season initiatives.

What industry trends are shaping the Holiday job market?

The Holiday sector is increasingly driven by AI‑powered inventory forecasting, personalized gift recommendation engines, and sustainability in packaging. E‑commerce growth, especially on mobile platforms, fuels demand for digital marketing specialists. Companies also prioritize real‑time customer experience management, making roles in omnichannel retail and customer data platforms more critical.

All Holidays Jobs 7,465 jobs All Jobs in USA 865,288 jobs Holidays in Remote 4,735,872 jobs Holidays in Other US Location 4,119,713 jobs Holidays in New York City, NY 1,094,457 jobs Holidays in Multiple Locations 966,318 jobs Holidays in Washington DC 667,565 jobs Holidays in Chicago, IL 641,726 jobs Travel in USA 79,922 jobs Full Time in USA 46,687 jobs Retirement Plan in USA 43,124 jobs 401(K) in USA 38,310 jobs Health Insurance in USA 35,548 jobs Life Insurance in USA 33,616 jobs

Holidays Jobs in USA

Frequently Asked Questions

Related Pages